ValdemarsviksBladet april 2018

 

Embed or link this publication

Description

Gratistidning sedan 1992 i Valdemarsviks kommun med omnejd som kommer ut en gång per månad.

Popular Pages


p. 1

BValalddeemt arsviksNr4/2018 27april2018 ÅR - Sedan 1992 - Medborgarinformation Valdemarsviks kommun sidan 2, 3 och 14 Emil – En säljare av framtiden sidan 16 HEMBYGDSBERGET RINGARUM Smart Home Exclusive 9 Erbjudande! Passa på! Begränsad antal! 19 929:-Rabatt 8 191:- ordinarie pris: 28 120:- - Inbyggd WiFi - Bygghöjd 27,5 cm - Kastlängd 14 meter, till låg ljudnivå - Energiklass A+++ Priser inkl. moms, komplett installation och efter ROT-avdrag Mossebogatan 13, Valdemarsvik Telefon 0123-20 000 info@allvarmeteknik.se www.allvarmeteknik.se Öppet: mån-fre 8-17, lör stängt Turistcenter i Valdemarsvik AB | Storgatan 16 | 615 30 Valdemarsvik | 0123-121 81 | info@valdemarsviksbladet.se

[close]

p. 2

- Medborgarinformation från Valdemarsviks kommun - Välkommen att ta del av och Peter vill skapa bra äldrevård påverka en spännande utveckling I Valdemarsviks kommun Mitt namn är Peter Appelqvist och jag arbetar sedan augusti 2017 som biträdande enhetschef på äldreboendet Vammar- #mitteuropa #EUinmyregion höjden. Innan jobbade jag som biträdande enhetschef och samordnare på Tellus boende för ensamkommande barn i När: 8 maj kl 13.00-15.00 Var: Valdemarsviks Sparbank Valdemarsvik. Jag vill vara med om att skapa en bra Musikunderhållning kl. 13-14 Vi bjuder på Afternoon Tea! äldrevård i Valdemarsvik som grundar sig på kommunens värdegrund och en tillgänglighet för våra boende och våra medarbetare. Att göra så VI ÄR MED I MITT EUROPA Nu öppnas dörrarna till Mitt Europa. Tillsammans med EU skapar vi nya möjligheter där du bor. Besök ett projekt nära dig! mycket som möjligt med våra tilldelade resurser och att använda sig av kreativitet för att skapa detta, är något som jag tror på och som tilltalar mig. Genom att vara inlyssnande och ha ett öppet sinne tror jag att det kommer många värdefulla tankar och idéer i de olika kanaler vi har i Valdemarsvik kommun. Att ta tillvara på de positiva krafterna som finns och använda de resurser som finns i vår närhet, tror jag skapar en samsyn på hur vi vill ha det hos oss på Vammarhöjden. Vi har tre EU-projekt som finansieras av Interreg Central Baltic som handlar om stadsnära odling, utveckling av Fyruddens hamn och hur området Ekön kan utformas. Vi vill visa vilka möjligheter som finns med EU-projekt. Varmt välkomna! Hedwig Bjernersjö Projektledare Smart Marina & Coast4us Valdemarsviks kommun hedwig.Bjernersjo@valdemarsvik.se Telefon 070-601 44 16 Susanne Hamilton Projektledare Gardens of Possibilities Valdemarsviks kommun susanne.hamilton@valdemarsvik.se Telefon 070-349 41 79 Peter Appelqvist Biträdande enhetschef på äldreboende Vammarhöjden Öppet café för utvecklingen av Fyruddens hamn Valdemarsviks kommun bjuder in till Öppet Café för att diskutera gestaltningen av Fyruddens hamn. Läs mer om alla projekt som öppnar dörrarna för besök på www.eufonder.se/mitteuropa Broschyren ”Om krisen eller kriget kommer”… I slutet av maj kommer du att få en broschyr hemskickad till dig med rubriken ”Om krisen eller kriget kommer”. Det är MSB (Myndigheten för samhällsskydd och beredskap) som på uppdrag av Regeringen gör detta utskick till 4,8 miljoner hushåll i Sverige. Syftet med informationen är att vi ska bli bättre förberedda på följderna som allvarliga olyckor, extremt väder, it-attacker eller militära konflikter ger. Innehållet i broschyren upplyser om hur vi alla kan förbereda oss på att klara av vår vardag när viktiga funktioner i vårt samhälle inte fungerar som vanligt. Broschyren ingår som en del i den nationella kampanjen Krisberedskapsveckan, den 28 maj-3 juni 2018. Har du frågor/funderingar kring säkerhet och krisberedskap är du välkommen att ta kontakt med Valdemarsviks kommun på telefon 0123-191 00. Plats: Fyruddens Restaurang När: 3:e maj kl. 14.00-18.00 Vill ni vara delaktiga i Fyruddens hamns utveckling? Vi vill bjuda in er till ett ”Öppet Café” i Fyrudden där vi berättar om projektet Smart Marina och vilka möjligheter det kan göra för Fyruddens hamn. Därför vill vi gärna ta del av era synpunkter, önskemål och tankar kring hur hamnen ska utvecklas. Vi bjuder på fika! Varmt välkomna! Ingen föranmälan krävs Har du frågor om projektet kontakta: Hedwig Bjernersjö Projektledare Smart Marina Valdemarsviks kommun E-post Hedwig.Bjernersjo@valdemarsvik.se Telefon 070-601 44 16

[close]

p. 3

- Medborgarinformation från Valdemarsviks kommun - Valborgsmässofiranden 30/4 Ringarum, Hembygdsgården L:a Norrby kl. 19:30 Vårtal av Christina Béen. Fyllingarum, Fyllingarums Bygdegård kl. 20:00 Kl. 20:30 tänder vi brasan, följt av ett fackeltåg. Att förebygga båt- och båtmotorstölder Valdemarsviks kommun tillsammans med Polisen bjuder in till en informationskväll i ämnet. Karl Landström från Polisen är utsedd samordnare inom polisen, han ger praktiska tips och råd. Yxningens Camping, Gusum kl. 20:00-22:00 Vi sjunger vårsånger och tänder brasan. Tid: Onsdag 2 maj klockan 18:00-20:00 Plats: Funkishuset, ingång biblioteket,Valdemarsvik Skrickerum, Nämndemansgården kl. 20:30 Vårtal av Jan-Olof Risberg. Björkudden, Gryt kl. 20:30 Vårtal av Magnus Ek. Brasan tänds kl. 21:00. Gästhamnen, Valdemarsvik kl. 20:30 Vårtal av Lars-Olof Swartz. Brasan tänds kl. 21:00. Bandyplan, Gusum kl. 21:00 Vårtal av Christina Gårdebäck Stork. Skeppsgården kl. 21:00 Vårtal av kyrkoherde Mathilda Helg. Hej tonårsförälder! Securemark kommer och berättar om märkning och stöldskydd bl.a. om DNA-märkning. Länsförsäkringar finns också på plats och ger tips på hur man skyddar sig mot stöld. Securitas ger information om kameraövervakning och Axtech pratar om GPStrackers m.m. En späckad kväll som ger er praktiska tips på skydd för era båtar. Vi bjuder på kaffe! Välkomna! Fredrik Törnborg Samordnare Brottsprevention Telefon 0123-191 03 I undersökningar har man sett att de flesta tonårsföräldrar tror att de kan påverka sin tonåring genom att prata om alkohol i tonåren. Och det stämmer. Även om tonåringar säger att de inte bryr sig, och det är lätt att tro att kompisarna betyder allt, så lyssnar de på sina föräldrar. Forskning visar att ett konsekvent nej till alkohol från föräldrar är en gräns som tonåringar inte bara förväntar sig, utan även drar sig för att passera. Tänk på det inför Valborg! Vilken inställning har du? Din inställning har stor betydelse för om din tonåring dricker alkohol. Forskning visar att barn som blir bjudna på alkohol av sina föräldrar börjar oftare att dricka vid tidigare ålder och dricker även mer än barn som inte blivit bjudna hemma. Den som bjuder tonåringar på alkohol visar ju att det är okej att dricka fast man inte är vuxen än. Att inte servera alkohol till minderåriga, hur trevlig och belevad festen än må vara, är ett valborgstips som visar att man bryr sig! Föräldratips inför Valborg! • Prata med andra föräldrar om fester, alkohol, tider att vara hemma m.m. • Bjud eller köp aldrig ut alkohol till din tonåring – det signalerar bara att du tycker att det är okej att barnet dricker fastän hon eller han inte är vuxen än. • Visa att du bryr dig. Förklara vad du är rädd ska hända om ditt barn dricker alkohol. • Stå på dig. Tonåringar förväntar sig att föräldrar sätter gränser. • Kom ihåg – tonåringar bryr sig mycket om vad deras föräldrar säger. Fler tips finns i tonårsparlörer. Den finns på Systembolaget och på Fabriken, Valdemarsviks kommun. Fredrik Törnborg Team Fritid Telefon 0123-191 03 Seniormässa med hälsa och livskvalitet i fokus Den 29 maj 2018 arrangerar Valdemarsviks kommun och den lokala vårdcentralen en seniormässa i samverkan med det kommunala pensionärsrådet. Syftet är att informera och inspirera seniorer 55+ till en enklare vardag och ett hälsosammare liv med hög livskvalitet. Under dagen kommer det att finnas möjlighet att lyssna på föredrag, besöka hälsostationer, fråga experter och samtala med utställare. Boendefrågor, trygghet, hjälpmedel, diabetes, kost, fysisk aktivitet, demens, anhörigstöd och digitala tjänster är exempel på områden som mässan kommer att beröra. - På scenen kommer bland annat Inger Händestam från SPES (Riksförbundet för suicidprevention och efterlevandes börd) prata om psykisk ohälsa och självmord bland äldre, berättar Emelie Nisu som är projektledare för seniormässan. Klart är även att vårdcentralen kommer att berätta om sin nya äldremottagning och att kommunen informerar om de projekt som drivs för att ge våra invånare en bättre vård och omsorg. Programmet spikas i början av maj och kommer inom kort att publiceras på kommunens hemsida (www.valdemarsvik.se/ seniormassa) och den 25 maj finns programmet att läsa här i ValdemarsviksBladet. Seniormässan är gratis att besöka och arrangeras i Svenska kyrkans församlingshem på Kyrkogatan 17 i Valdemarsvik. Frågor och funderingar kan ställas till projektledaren Emelie Nisu, folkhälsoutvecklare på Valdemarsviks kommun. Telefon 0706-01 45 38. E-post emelie.nisu@valdemarsvik.se Vill du delta som utställare? Har du en verksamhet som går i linje med mässans budskap är du välkommen att ställa ut. Kontakta projektledaren för mer information. VALDEMARSVIKS KOMMUN Besöksadress: Kommunhuset Strömsvik, Storgatan 37, Valdemarsvik Telefon: 0123-191 00, E-post: kommun@valdemarsvik.se www.valdemarsvik.se

[close]

p. 4

Vårdcentralen Valdemarsvik informerar Huggormsbett Huggormsbett gör oftast ont och visar sig som två små prickar bredvid varandra på huden med 6-9 millimeters mellanrum. Det är vanligt att det uppstår en blåaktig svullnad runt bettet. Svullnaden kan sprida sig till hela den bitna kroppsdelen. Åk till sjukhus Alla som har blivit huggormsbitna bör observeras på sjukhus. Även om du är opåverkad ska du inte åka ensam utan be om hjälp med att ta dig dit. Vid allmänpåverkan som illamående, kräkningar, magsmärtor, diarré, yrsel, kallsvettning, hjärtklappning, svullna läppar eller andningsbesvär ska du genast ringa 112 för att få hjälp med transport till sjukhus. Pollenallergi Pollenallergi, som också kallas för hösnuva, ger besvär som röda, kliande ögon, nästäppa, upprepade nysningar och rinnsnuva. Hur svåra besvär du får beror på hur känslig du är och hur mycket och vilka typer av pollen som finns i luften. Vad kan jag göra själv? • Vädra sovrummet på natten eller tidigt på morgonen då pollenhalterna är låga. • Häng inte ut kläder eller sängkläder på vädring eller tork utomhus. • Motionera utomhus på morgonen medan daggen fortfarande binder pollen eller undvik helt att motionera utomhus. • Undvik att vara på en nyklippt gräsmatta eller klipp gräset när det är daggvått. • Skölj bort pollen ur håret innan du går och lägger dig. • Ta inte in växter med pollen inomhus. • Undvik kontakt med husdjur som varit ute och fått pollen i pälsen. • Ha fönstren stängda under dagen. • Byt kläder när du har varit utomhus. • Följ pollenprognoserna för att vara förberedd på höga pollenhalter i luften. På apoteket kan du få råd om lämpliga receptfria läkemedel för behandling av besvär i ögon och näsa. Ofta kan du klara behandlingen själv och bli helt symtomfri med hjälp av receptfria läkemedel. Övrig bokning och telefonrådgivning är öppen alla vardagar kl. 07.30-16.30, telefon 010-105 92 90 Om du vill förnya recept, hämta sjukintyg, läsa din journal eller avboka tid för bokat besök och har tillgång till internet kan du komma i kontakt med oss på adressen www.1177.se Charlotte Kettle Vårdcentralschef Telefon: 010-104 46 57 E-post: charlotte.kettle@regionostergotland.se 4 Målning © Sara Åman

[close]

p. 5

Grön Vecka14-19maj Boka in dig på någon av våra spännande föreläsningar: Måndag: Eva Bodfält - ”Hur blir jag en magnet för min hund?” Tisdag: Johanna Lassnak - ”Ryttarinspiration” Onsdag: Henrik Valentin - ”Om lusten att trädgårdera” Torsdag: Per Frankelius - ”Grönovation” samt 18-19 maj Magnus Samuelsson - ”Från Valstad till Vegas” Grönt veckoslut Köp biljett via www.gamlebygymnasiet.nu Butik, showroom eller kontor? I våra tre lokaler på Storgatan erbjuds fina möjligheter. Vi kan anpassa dem efter just ditt företags behov, t ex genom vårt samarbete med arkitekter som bistår med intressanta förslag på lösningar. Kom och titta på lokalerna och känn in atmosfären i Valdemarsviks mest centrala läge. Ring oss på 0123-106 10 så berättar vi mer och visar lokalerna. Välkommen! Folkan Bio Gusum Den största kulturscenen i kommunen Film, Opera, Konserter och Konstprogram BIO AVENGERS: INIFINITY WAR 80 kr Fredag 27 april kl. 19.00 2D ISLE OF DOGS 70 kr Söndag 6 maj kl. 15.00 GUERNSEYS LITTERATUROCH POTATISSKALSPAJSSÄLLSKAP 80 kr Söndag 6 maj kl. 18.30 GHOSTLAND 15 år, 80 kr Fredag 11 maj kl. 19.00 DEADPOOL 80 kr Fredag 18 maj kl. 19.00 Söndag 20 maj kl. 18.30 Onsdag 30 maj kl. 19.00 SOLO: A STAR WARS STORY 80 kr Onsdag 23 maj kl. 19.00 Fredag 25 maj kl. 19.00 Söndag 27 maj kl.18.30 MUSIKAL PÅ BIO AN AMERICAN IN PARIS Gershwin-musikalen från Dominion Theatre, London 140 kr, 2 tim 40 min Onsdag 16 maj kl. 19.00 KOMMANDE FILMER PÅ BIO: JUNI: LasseMajas Detektivbyrå Det första mysteriet Jurassic World: Fallen Kingdom JULI: Biet Maya - På nya honungsäventyr Den blomstertid nu kommer Ant-Man and the Wasp The First Purge Hotell Transylvanien 3: En Monstersemester Mamma Mia! Here We Go Again Varghunden Med reservation för ändringar. Kenneth 070-629 64 37 Folkets Hus 070-640 21 92 Bokning/förköp: www.folkanbiogusum.se Korpen Valdemarsvik 60 år! Det firar vi närmast med Tipspromenadfinal, boulemästerskap för tvåmannalag, straffsparkstävling, cykling på Banvallen mellan Gusum och Valdemarsvik! Lördag 5/5 kl. 10.00-13.00. Start på tipspromenaden 10.00-11.00 Vandringar med Korpen torsdagar: 3/5, 17/5, 24/5, 31/5, 7/6, 14/6 Vandringsresa till Hövringen 2/9-6/9 med helpension och ledare Bli medlem i Korpen Stöd vår verksamhet för Din motion och hälsa! Välkomna med Korpen hälsar Birgitta, Kenth, Ewa, Janne, Åsa, Janne, Monica, Lennart och Göran! Välkomna till Banvallstugan och Korpen Valdemarsvik! Upplysningar: 070-699 33 34 ∙ 070-657 25 13 5

[close]

p. 6

KVARNEN, VALDEMARSVIK FÖRSLÄPP - Årets första föl släpps på grönbete ÖPPETTIDER: Onsdag 9/5, torsdag 10/5, fredag 11/5 10-18 Lördag 12/5, söndag 13/5 10-15 Fredag 18/5 10-18 Lördag 19/5 10-15 VÅRREA! UTFÖRSÄLJNING AV SYMASKINER! PASSA PÅ!!! BYT UPP DIG! SKAFFA DIG DIN FÖRSTA SYMASKIN REPARERA DIN GAMLA 25% URPPATILBL ATT NYA OCH BEGAGNADE HUSQVARNA Viking Tribute 145M Folkets Hus, Valdemarsvik Onsdag 2/5 kl 1030-1730 Lunchstängt 1330-1400 Välkomna! Service utföres på alla fabrikat! Håkans Symaskinsbutik - mer än 25 år i branschen - Rågången 71, Norrköping 011-28 76 60, 070-763 43 71 www.hakanssymaskinsbutik.se KLIPP UT OCH TA MED - GÄLLER 2/5 2018 • 300 kr i rabatt på symaskinsservice • Skräddarsax erhålles utan kostnad vid köp av valfri symaskin VÄRDE 349:- 6 12 Maj kl. 11.00-16.00 För detaljerat program se vår hemsida www.holmtebo.se I samarbete med Norrköpings fältrittklubb bjuder vi in till öppet hus med fölsläpp, uppvisningar, Hagvandring och �lera lokala hantverkare, som alla �inns hos oss och visar upp och säljer sina produkter! Kom och se gårdens hästar och verksamhet. Du kan också passa på att lära dig mer om solel, då Emil från El av sol �inns på plats och berättar. Vi hoppas kunna ha vår Solelanläggning på plats! Fika med hembakat Johan , Elisabeth och Gustav Ljungstorp mobil: 070-6012660 eller mail : ljungstorp@yahoo.com Länstidningen Östergötland är en prenumererad nyhetstidning som utkommer varje fredag och har läsare i alla Östergötlands 13 kommuner. Länstidningen startades 1948 och skriver framför allt om människor och händelser på den östgötska landsbygden. Varje vecka innehåller tidningen minst en sida från var och en av Östergötlands 13 kommuner med lokalt material. Nära läsning! Frilansskribenter sökes! På grund av skiftande omständigheter behöver vi omgående fler frilansmedarbetare som kan täcka framförallt Valdemarsvik och Söderköping. • Tycker du om att skriva och fotografera och har ett stort intresse för din hembygd kan du vara exakt den vi söker! • För dig som är äldre kan detta bli det perfekta extraknäcket att dryga ut pensionen med. Är du ung kan det ge en välkommen förstärkning till kassan och en nyttig erfarenhet inför framtiden. Ansök så här: Ansökan med kort beskrivning av dig själv sänds till redaktionen@lanstidningen.se. Skriv "Frilansskribent" i ärenderaden. Eventuella förfrågningar hänvisas till samma e-postadress. Förfrågningar per telefon undanbedes vänligen men bestämt. Vi vill ha din ansökan snarast möjligt! Läs gärna mer om tidningen på www.lanstidningen.se Välkommen med din ansökan!

[close]

p. 7

Trubadur: Anders L Jonsson Hundfrisör Hundpensionat 0733-799 562 Ringarum www.helenashundtrim.se Grillkväll på värdshuset med trubadurunderhållning! Lördag 26 maj kl. 19-01, Pris: 249 kr/person Vi serverar en buffé med bland annat vildsvin, nöt- och fläskkött, kyckling, lax, ugnsrostad potatis, sallader, såser, bröd & andra goda tillbehör. Vid grillen står Peter Lindgren Välkommen att kontakta oss för bordsbokning! Telefon: 076-138 94 07 eller mail: maria@ringarums.se Fästingbussen kommer till Er och utför TBE-vaccinering på plats Västervik Maxi ICA Supermarket Söndag 6 maj kl 12-16 Valdemarsvik ICA Supermarket Fyren Måndag 7 maj kl 15-19 Ett fästingbett kan räcka Söderköping ICA Tempo Trollet Tisdag 8 maj kl 14-18 Du kan vaccinera dig mot TBE Pris vuxen: 370 kr | Pris barn: 320 kr Titta in på glomstapoolen.com för övriga stopp Valdemarsvik har en stor andel äldre invånare därför är äldreomsorgen ett område av yttersta vikt för kommunens framtid. Valdemarsvik har också en vision där det står ”Hela kommunen skall leva”. Detta skall också genomsyra kommunens äldreomsorg. Äldreomsorgen Anhörigstöd Äldreomsorgen i kommunen är helt beroende av de insatser som anhöriga gör. Därför är området Anhörigstöd prioriterat för Moderaterna i Valdemarsvik. Det stöd som erbjuds för dig som vårdar eller stödjer en anhörig i hemmet anpassas efter ditt individuella behov. Äldreboende Nya Moderaterna kommer att verka för att det nns boende i alla de stora orterna Även de mindre äldreboende behövs. Åldersro och Gusums Äldreboende ska vara kvar. Hemtjänsten Statusen på arbetet i hemtjänsten höjs genom att hemtjänsten delas upp i två delar. En för personlig omvårdnad och en för hushållssysslor. Väntjänst Frivilliga väntjänsten som är ett medmänskligt stöd och ett komplement till samhällets insatser utvecklas. Moderaterna Valdemarsvik 7

[close]

p. 8

VAMMARDAGEN Fredag 11 maj Vid norra infarten till Valdemarsvik - 2 minuter från E22 HÄSTBUTIKEN I VIKEN Restaurang Vammar Radio Wix Aktiviteter för hela familjen Röda Korset Waldemarsviks Träbåtsförening Valdemarsviks Sparbank Lions Baklucke- loppis Hjärtligt välkomna! Kanonerbjudanden i alla butiker Företagen visar upp sina verksamheter m.m. 8

[close]

p. 9

STORT TACK Till mina kunder för alla fina presenter och blommor som jag har fått, nu när jag slutar efter 25 år. Tack för alla trivsamma stunder som vi har haft. Britt Inger Franzéns Fotvård GRATIS GLASÖGON FÖR BARN Synundersökning tillkommer Ring och boka tid: 0123-510 00 Storgatan 9, Valdemarsvik Lagerrensing utanför butikerna! 11-12 maj Vi säljer även kaffebönor, te i lösvikt & praliner! STORGATAN 9 ∙ VALDEMARSVIK ∙ 0123-100 80 Öppet: måndag-fredag 10-18, lördag 10-13 TÖM VÅRA LAGER! Citas Kläder Vi säljer även inredning & handdukar! STORGATAN 8 ∙ VALDEMARSVIK ∙ 0123-120 33 Öppet: måndag-fredag 10-18, lördag 10-13 KARBASEN Kök och Catering Vi lagar mat från grunden och använder ekologiska och närproducerade råvaror. Lunch alla dagarföÖrpaplleat! kl. 11.30-14.00 - även avhämtning - Catering till fester och arrangemang Smörgåstårtor, mackor, sallader och specialkost Evelyn hälsar alla välkomna! 073-824 76 48 Storgatan 72 ∙ Valdemarsvik karbasenskok.webnode.se Helgens prisbomb Helgens prisbomb 9-20ALLÖAPDPAEGTAR Helgens prisbomb Helgens prisbomb Känn dig som hemma! Helgens prisbomb 6990 /kg Grillskiva av bog Sverige Manuell disk för ost, fisk, kött och deli. Vi grillar och bakar 7 dagar i veckan Helgens prisbomb Gäller fre 27/4-sön 29/4 SALLADSBAR GOTT & NYTTIGT! 8900 /kg Brännvinsost Lagrad 14 månader Ostspecialisten Gäller fre 27/4-sön 29/4 FÄRDIGA SMÖRGÅSAR Vammar Köpcenter Valdemarsvik Telefon 0123-196 90 Delikatess 0123-196 96 FISKDISKEN FÄRSK FISK VARJE VECKA! (Från tisdagar) www.hemkop.se Följ Hemköp på Facebook! www.facebook.com/Hemkop 9

[close]

p. 10

Boende och mat till nära och kära i trevlig miljö Hjärtligt välkomna! bed and breakfast • catering • konferens kajakpaddling • westernridning Boka på 0123-407 00 eller www.grytspensionat.se - en mänskligare värd - Välkommen att besöka oss på Storgatan 1 i Valdemarsvik Flytta till oss i Valdemarsvik eller Loftahammar! Vi har lägenheter både centralt och nära naturen Vi finns även i Västervik och Vimmerby För visning och information ring 0123-510 90 info@fogelvikfastigheter.se www.fogelvikfastigheter.se Fyrudden Restaurangen och Fyruddens Livs har öppet alla dagar! Glass och kafé Premiär Kristi Himmelfärdsdag Aktuella öppettider hittar ni på: www.fyrudden.se Hjärtligt välkomna! Lise-Lotte och Ola med personal Restaurang • Livsmedelsbutik • Glass & Kafé Vandrarhem • Båttillbehör • Sjömack 0123-402 10, 401 61 eller fyrudden@hotmail.com VÄLK-OMMEMNEANRPEÅAELNLOLWADEDIESTONOIG-HT! 26/5 17-20 Skönhetsbehandlingar av många olika slag av både lokala och rikstäckande aktörer! Mingel, bubbel och skönhet i en härlig mix erbjuds denna kväll. Skön shopping i stora salen. Varmt välkommen både medlem och ickemedlem! Du hittar oss i Sjöhusets lokaler i Valdemarsvik. Varmt välkommen till oss! Mer info finns på vår hemsida www.halsobruket.se Telefon 0771-100 333 10

[close]

p. 11

Äga travhäst tillsammans! Solkattens Blossom Sto 3 år Solkattens Ferrari Hingst 2 år Andelsägarekoncept om 30 andelar! Lördag den 28/4 visning av hästarna på Mantorp Vid intresse ring 0705 89 09 39 Spela golf i en avkopplande miljö - endast några kilometer från havet - Inga köer, låg greenfee. 9 hål + 9 alternativa utslag. Det finns även shop, cafeteria, driving range m.m. Vi erbjuder även nybörjarkurser! Välkommen till skärgården! Tel. 0123-404 79 www.waldemarsviksgolf.se Marina | Gästhamn | Hotell | Restaurang Konferens | Relax | Events Telefon 0123-128 06 E-post anna@grytsvarv.se Välkomna www.grytsvarvhotellkonferens.se FFrruuEEppkkttllttaattttnnaarräättxxooddpprr,,ll,,oobbccäämmkkrrbbaaaagguuSSvvnnssäävvkkoottttaallaaiipprrddaaoo,,vvoottppaaiicceehhtthhrriieeaassmmnnrryynnhhcceeeekkrrmm,,eerrttmmaammaabbaaeennrrrruu!!bb::eerr-- NNEEyyggoohheessnneessttoomm::ddCClleeaaaaddddrrJJuueeoooottllggrriikkddrrnnööööeeffrrnnrrnnuuppssååiittaallnnnnaaffkköönnggHHssrrttppiiaaoonnnnllssaarroouussnnmmeessttllooffookkoorrrroorrggoommssbbcciihhmmnnddttuuooeennmmrreeiinnaahhttoo--ss ÖÖppppLeeöttrttdiiddageerr& vvSaaönllbbdooagrrgg1ss0hh-1ee5llggeenn:: VaLlöbrodraggsm&äSsösonadfatgon101-01-515 1 Maj 10-V13alb(öovrrgisgmaätsisdoearfsteonhe1m0-s1id5a eller Fb) 1 Maj 10-13 (övriga tider se hemsida eller Fb) Instagram: Instagram: @grytshandelstradgard@grytshandelstradgard- grytshandelstradgard.segrytshandelstradgard.se- info@grytshandelstradgard.seinfo@grytshandelstradgard.se- 0702-804798 0702-804798 11

[close]

p. 12

telefon: 0123- 21 000 fac Hej alla glada kunder! Nu har vi snart avverkat april månad och äntligen har vädret vänt! Vi tror och hoppas på att det går att vara ute och grilla på Valborgsmässoafton! Vi har laddat veckans reklamblad fullt med allt som grillen kan tänkas behöva! Passa även på att arbeta ute i trädgården när det är långhelg, är vi som tidigare billigast på jorden tro? ;-) Ha en riktigt härlig långhelg och Välkommen hem till oss! KarrékotletterValborgsKLIPP - gäller fre-sön.v17 - 51% RABATT! 39ªButiksstyckade. Benfri. Sverige /kgegeKnrygdoddaadgerimllkerdydvdåar! Ord.pris 79,90 kg Spara 40,90 kg. Gäller vecka 17 ValborgsKLIPP med ICA Kort - gäller fre-sön v17 - 44% RABATT! Potatissallad storburk 15ªICA. 1kg Färska hamburgareValborgsKLIPP-med ICA Kort – gäller fre-sön v17 - 42% RABATT! 25ªICA. 452g Ord.pris 42,90 Spara 17,90 Max 2 köp/hushåll Gäller vecka 17 HamburgerdressingValborgsKLIPP med ICA kort – gäller fre-sön.v17 - 44% RABATT! 9ªICA. 230g Ord.pris 26,90 Spara 11,90 Max 2 köp/hushåll Gäller vecka 17 ValborgsKLIPP med ICA Kort - gäller fre-sön v17 - 46% RABATT! Vitlöksbaguetter 7ªICA Basic. 2x175g Ord.pris 15,90 Spara 6,90 Max 2 köp/hushåll Gäller vecka 17 ValborgsKLIPP med ICA kort – gäller fre-sön v17 - 50% RABATT! Marinad i påse 25ªSanta Maria 5 st Frysta Ord.pris 12,90 Spara 5,90 Max 2 köp/hushåll IsterbandVärdekupong! 45% RABATT! 22ªICA. 300g 2 st Gäller vecka 17 Ord.pris 9,90 st Spara 24,50 Max 1 köp/hushåll FärskpotatisVärdekupong! 45% RABATT! 22ªICA. 900g. Cypern/Egypten 2 st Gäller vecka 17 Ord.pris 19,90 Spara 17,80 Gäller vecka 17 Ord.pris 19,90 st Spara 17,80 Gäller vecka 17 12

[close]

p. 13

Öppet alla dagar 9-21 cebook.com/icabirgersson Passa på, kolla priset - 39% RABATT! Kambenspjäll 49ªButikstyckade. Sverige egeKnrygdoddaadgerimllkerdydvdåar! /kg Ord.pris 79,90 kg spara 30,90 kg Gäller vecka 17-18 Extra BILLIGT med ICA kort - 53% RABATT! Potatiskroketter 8ªICA. Frysta. 600g Passa på, kolla priset - 43% RABATT! Hel färsk laxsida 119ªICA. ca 1100g /kg Ord.pris 205,90/kg Spara 86,90/kg Tillfälligt KLIPP - 48% RABATT! Gäller vecka 17-18 Matjessill 20ªKlädesholmen. 200g 3 st Ord.pris 16,90 st Spara 8,90 Max 2 köp/hushåll Gäller vecka 17-18 Extra BILLIGT med ICA Kort - 37% RABATT! Äkta fetaost i bit 25ªICA. 150g 2 st Ord.pris 12,90 st Spara 18,70 ! Max 1 köp/hushåll Gäller vecka 17-18 Extra BILLIGT med ICA Kort - 47% RABATT! Mandelkubb 20ªICA. 10-pack x 31g 2 st Ord.pris 19,90 st Spara 14,80 Max 1 köp/hushåll Ord.pris 18,90 st Spara 17,80 Max 1 köp/hushåll Gäller vecka 17-18 Gäller vecka 17-18 Extra BILLIGT med ICA Kort - 43% RABATT! När du handlar andra varor för minst 150ª Säsongspremiär & ny leverantör! Planteringsjord 10 st 199ªICA Garden. Större säckar, hela 50l samt högre kvalité! Ord.pris 34,90 st. Spara 150ª Max 1 köp/hushåll. OBS! Gäller ENDAST planteringsjord I sortimentet finns även Täck & Barkmull-Toppdress och Naturgödsel 50l. och då får ni blanda fritt 4 säckar för 100ª Ord.pris 34,90 st, Spara 39,60 Gäller vecka 17-18 13

[close]

p. 14

- Medborgarinformation från Valdemarsviks kommun - Vi har blivit kulturskola 2018 Äntligen har vi blivit Kulturskola! Mässa för jobb och integration 22 maj 2018 Mässan äger rum tisMdaugsikdseknola2n2fymlleajr 6i 0Foålrk!ets Hus och invigs klockan 18.00. SyfteDt amnesvdemrkässtsaannfyälrleartt20föråert!ag ska få möjlighet att visa upp sig samtidSiglötjdsoklmubablelan afryblleetrs2söåkra! nde i Valdemarsviks kommun ska få en chans att träffa potentiella arbetsgivare. Valdemarsviks kommun ses av många som ett föredöme när det Det ska vi fira!gäller integration. Körkortshjälp, Nyföretagande, Flykting söker bonde och GrönInIbntjuegdraantiotinll är bara några av alla framgångsrika InbjudapMnrotjäiellksts. Nauftöarrkjoombmbunoecnhettinnytettggrreaptpioocnh ordnar en Jobb- och jobb oinctehgriantitoengsmraätsisoantillsammans med Arbetsförmedlingen. 22 majsD2tä0el1tle8ärr viktigt att2t2ydmliaIgnjgb2öju0rda1aa8ntttildl et inte förväntas från företag ut Mattädsesakofmörmjoebr battoecrhbjiundtaegjorbabtioelnler anställning. som - Vi ville skapa ett 2h2emltajn2y0t1t8 sammanhang för arbetssökande, oeoötktetcntmranhf.vuötmfiMitisåSsDernseaöelyuttäelkteäfanustaänaglelpsrangaatrcavdprarätbtnssäsehetntraliasiekkaoyadsnoigätmoatgknnaesctmraassgnlfhfovtöagmårmfiaåcvaerlberreeähaämaterbeptntnrasnktsoneåeöigastsödcsärcttajosJhätlkatsaibhkvcadgoaffimpa,neåheVrhbasearldfaateåbksha.nrapelrtaed-mttepoäbt,aenfvåoötttrösemtriejceJiältlariktonngoffharmvseuhbactrgigtitesisbtoehnpsistuvi-adlocttvlailtoieäkatibgthluaectv!gloutnlphravartdcseimpriaisrenbokoeatsltlsmieekaaeocouoigtgpmadahnsrcanpransgabhrotfibmsyieirocvncibtegabnmshaänitesgoevsrssmismnecav-tisöhaäälaraosrsketknersavcaidäeanoemhtVr.vcleiraaeehksVD.dhrlmaaekdslsäae,deävf,melsvmriöslmilaelakkraaamfmeearörrtsttst.aiuvrdiuvsditteOikbigtitik!nbggut!cdsuti,monhdssmhoogsömidmaatoträtrfibmaanaresnktr.sfisbnna-neynyDntiassnv-äfkirlsyuatfntöudarpdeepre-, ndeirksoimgmtoiullncdehnig. Masärosbmseantäsärs:rögrkataisnbdådee fköar untstsälelareviolckhebtesöuktabreu. d som finns i kommunen, öi rVeatMladägesamsraeansrväsoävgcnihkedserarkrDsobigmejttaimlslmgduiingvaaslsoroHemmiäaVvrm:iallldmaeialmrik,aniransdtvseikfgösrrakaotimomnsusnasmomorvdilnl maraer.knadsföra aigk, uknndyet—ar, EskaoFdvmnöiegtar,aenrktkbaentegymeattsarr,epakhaonoicrntgthttnaaeaektrntrbeyäoer,atcrhshgikettiuvmatatnnreedyudaeianVkrr,auibklsndedaetteammtrr,aieaslr.asrlbfvmäiekalstrlbskeepotmfasöprmtarnurtennnresärooromcicnhhvigmlml smeeldaidavrkrabnoreabtcdaeshrteföa.arraer.betssökande eeönmrtrkaemsnnatainmfrögoh—rceecsahlitlkvte,kvFitralleaösoramnrckvensmsnkakanöianhrmeatgäanhnableleyseeglrtlae,therorlöspoamacocvrtnekheeminassrdaenkvanlfeyinnönlramlestravypmtmäirntsbeelatalsadaåelfr.eukdönmoptroeacpmncnhtuaievtfrtrökaiolsraskctcnahätivsmeklilklasrhaena.äsrmKbkelhleeeäootbhllmeecösthohvösmemovbremurvaevaninsilnllleösvvttnkäiäisslaalaalhar.uea.up.rpppedräerr för valt att det Nnöeaftyrraoeåimnncgnfltheoienydrrvt,gitoldpaal—coirdvgh,aa-leiktspttvdiaTfNoDkotaöiaetfymmrsmteöimhrensnmCefloraetisinyretdcVöuptgbtohttdnkaaåaaomlirderAg,igcaerrkrnsdvhtpebootaiayetmnremdptrdenatbmCrisssnbaseVföuembatoöetnkanoemrerrhfmcteemrraaohpöåafidenrecdgrnvemdbatdhisonneelerieasnrftirrvnbe,öxgfiotiralrpeaoelåekcnancotgnvtohthaavoel.esmirgrrtvptt,iieoua,mäklpalc.eoltvsmuhlslerVisantptteioaaekäafriecnsmlporosh.lheoåaalmrkcAorpaoheårpmvtobAtaapocrevtpbdthatacerspdashtsrfssasotöfaeotöamreamrrmtmmxmtdfifiteeeenrdndemddnalniltsnfiötsnfägriöargeseokirntsoeeskal.maniotgogan.,mmmgtu,mknäeeourntnm.tdebenmrt.aearttitllloffläcelkrlaae APa2Viln(mdagamm:täaldslaiälle:eij,lmrka0luna71tr:6s8sDmm-tv:1ä0iTAP0lkåa0jlialandann4-rmm:tFST9egs2ä,ioe:k21saalilan2n:dakl0nba8taen0e:H,segtsetbsglda2eölheösemukSFTTdrmörnoiijesslaaaklalnadmk2Draiaijaee2rajilsVgta(eislt.g.ma.)mVhd2FhälaaedumlaamlönlseeHjlaar2mdirkaji2Vl(mdilueg@aam1ätamlervdslai8slalneeitjv,:lamärdk00islleruk0a7l1moatsr6s8s-vr-mtav:e1ä0ir2i0lks,k0l1av4is-,rin:k9e0ö2t.ä,s021ekire2n:0e8tb0e,dreebesjleloeötsrtökbakabarreeeet))ltlejrätvtiellbvraettailmlfäelrleo,msävgaedr li@valdemAaatrrstvbfiikTden.tijslaslnemfDaöajsarl.mmphåaaeKUmlodppHnpalltagaiialnemikt@tsfgpöa.veerieaDlrinst,laod0geneäe7,mtrkm6so-aonm1barm0simlenv4mnduik9mo.ecoms2hre2ceer8bhno,lckaeahonlrrlmetrdpraarinelaasdngerneentsraasat.tiornb.merääststaanomochvilkkoemt smtöedr ooVkhgnraaved,rärtmmsflelrgoåtnfunebavnlimälalnlarmnkuI0mKmgDrvaomnooe1nmomnaöjctmg2atevnhnjmöeöm3eglAaUKätrjerirerl-tkeragnopinetaaogndn1kagnlhpllclkht.åe9enettgiheoearHn:fo1ertotkuomafttneemtåimfapl7lrparseöll!mrsi9eaaAstreleddaataetonrstnuutsmdatbtgeemltaåoireioVölnkhepnglolnhonratiaasvetersad,mfissriärlrdettölmkmt.isttfleoednttalr0ringuoåantnbrlefa7lu.neoVbakhvtrer6anavlaimhädlelalLårtäran-gmläartmunflennknVulr1rtggåvtysatrfomjmaoout0neatovnimämrndlnlnämcla4mebgdelslltlahrmäkmnöNeraöadebevnaao9oirtrmjerynnrd.tbmemnlne2trineggaaettognnmaeöeölsntlocsksh2r.jrkesrselelcohioeöettsr8gnnrähölvrsmlth.yoemltdaleearimt!prktaoee!armirreldra!isdbudneuergöneötntssnsabsssstkk.öeiaoahrknroa.lLåanvälnnnLå.atdgystännaDtnatietägrdnystelslatlatäenNaiakärdnnirteyndtblaslktlägaaentNaansntonoisrtsysndtblcmötttsähgöaaestltdalsntamoäs!sslcröttäehköslrdalaa!äsvinena Den här vårterminen och nu i april firar vi att vi blivit KULTURSKOLA 2018! Hur firar man detta? Jo, vi ville självklart dela detta med våra nya och befintliga elever så under vårterminen bjöd vi på undervisningen i Kulturskolan för barn och unga. Och det passade alldeles utmärkt att vi blev Kulturskola just detta år för samtidigt fyller Musikskolan 60 år och Dansverkstan 20 år samt Slöjdklubben 2 år. Under ”Dansens Vecka” i Östergötland firade vi Kulturskolans kväll den 25/4. Och det blev en härlig blandning av olika kulturuttryck med duktiga elever och lärare. Kulturskolan består av Dansverkstan, Musikskolan och Slöjdklubben under detta år. Fasta kulturaktiviteter hos Kulturskolan är musik, dans och ytterligare aktiviteter skall vara variabla och följa barn och ungdomars intresse inom kulturområdet. Varmt välkomna till oss! Gun Töllefsen Kulturchef Frukostmöte: Valdemarsviks kommun möter det lokala näringslivet Sista onsdagen varje månad har du som företagare möjlighet att träffa representanter från kommunen under ett frukostmöte. Ta chansen att ställa frågor och diskutera! När: onsdag 30 maj 2018 Tid: kl 08:30 Plats: Lilla Blå Café & Restaurang Rådgivning för nyföretagare Går du i tankar att starta eget företag, ta över ett företag, generationsskifte eller är i uppstart och bor i Valdemarsviks kommun kan du kontakta Ekubator för kostnadsfri rådgivning. Syftet med rådgivningen är att stärka dig som företagare och att du ska komma igång med verksamheten snabbare. Ring 0703-80 99 30 eller mejla info@ekubator.se för att boka tid. Vi finns på Idrottsvägen 1A i Valdemarsvik, Guldnyckelnfastigheten. (Kontoret är inte alltid bemannat) VALDEMARSVIKS KOMMUN Besöksadress: Kommunhuset Strömsvik, Storgatan 37, Valdemarsvik Telefon: 0123-191 00, E-post: kommun@valdemarsvik.se www.valdemarsvik.se

[close]

p. 15

TmyesdklLaünbdec2k7--H31a/m5 bu rg-Schwerin 5.400:- Legoland 28-30/6 fr. 2.250:- Ghost, Chinateatern 27/10 1.360:- Nya hyss med Hjalmar & Gänget 10/11 1.280:- Så som i himmelen, Oscars 24/11 1.450:- För aktuella resor se vår hemsida www.uknabusstrafik.se Telefon 0493-500 21 Vi säljer TRÄDGÅRDSMÖBLER från Hillerstorp Hemleverans kan ordnas Konstrottingmöbler, grupper, solstolar m.m. Välkommen att besöka vår ca 300 kvm stora utställningslokal med utemöbler! Öppettider möbelförsäljning 23 mars-7 juli 2018: fredagar 15-18 samt lördagar 10-13 (Övriga tider efter överenskommelse, ring 0120-400 83 alt 070-207 76 96) Titta in på vår hemsida www.sjobergalanthandel.se för mer info Passa också på att besöka vår välsorterade lanthandel ICA-butiken har öppet: mån-ons 9-18 tors-fre 9-19 lör 8-13, sön 11-13 Gusums El Service AB Välkommen och gör ett besök i vår butik, vi har ett stort urval av artiklar t.ex färg, tapeter, lek, trädgård m.m Välkommen till 2:a våningen på ICA Birgersson Telefon 0123-207 02 Tel. Göran 0705-509 903 Tel. Pentti 0706-572 532 Våröppet Butiken med det lilla extra... 0493-420 00 Lördag-Söndag 13.00-16.00 Extraöppet: Kristi Himmelsfärsdag 13.00-16.00 Välkommen till Östra Ed www.svenska-presenter.se Sommar… …i Lindas Trädgård! Massor med nyheter och många gamla favoriter! • SOMMARBLOMMOR • GRÖNSAKSPLANTOR • KRYDDOR & ÖRT ER • PERENNER • PRYDNADSBUSKAR & ROSOR • BÄRBUSKAR •JORD, GÖDSEL & mycket mera! Vecka 27 har vi T EMAVECKA: ROSOR! Kontakta oss för mer information. Måndag-fredag Lördag Söndag Varmt Välkomna! Linda med personal Ordinarie: 10-17 10-14 Stängt Maj-juni: 10-18 10-15 10-15 Vecka 29-31: 10-14 10-14 Stängt Växthusen, Gamlebygymnasiet Tel. 0705-77 44 86 www.lindastradgard.com Unna er en god måltid som vi lagar på utsökta råvaror från våra nära gårdar och odlingar. Och kaffet smakar som alltid lika gott, helst med något vi bakat själva eller kanske en Sänkdalens Glass! Luncherbjudande! 95:- inkl. kaffe vardagar kl. 11.30-14.00 Öppet varje dag! April kl. 9-17 Maj kl. 9-19 Välkomna! Pia Wahlman med flitig personal Vid E22 södra infarten, Valdemarsvik 0123-300 87 15

[close]

Comments

no comments yet