Mount Pleasant High School Student Handbook 2016-2017

 

Embed or link this publication

Description

MPHS Student-Parent Handbook for 2016-2017

Popular Pages


p. 1

maining 4 addition, ulfill any rollment. elective credits are divided as; (2) credits of any combination of either CTE, Arts or second languages with the remaining 4 credit strongly recommended to be from one of the following: CTE, ROTC, Arts or any other subject area. In addition, students are required to pass any and all tests required by the North Carolina Department of Public Instruction and fulfill any other state-required learning outcomes. Note: A curriculum guide is given to each family at the time of student enrollment. In addition, see CCS website to access for details. elective credits are divided as; (2) credits of any combination of either CTE, Arts or second languages with the remaining 4 credit strongly recommended to be from one of the following: CTE, ROTC, Arts or any other subject area. In addition, students are required to pass any and all tests requPirRedObGyRthEeSNSoRrtEhPCOaRroTliSna Department of Public Instruction and fulfill any Potrhoegrresstastree-preoqrtusirwedilllebaernisisnugedouattcothmeehsa.lfNwoatye:poAinct uorfreicauclhumquagrutiedrelyisgrgaidvienngtpoeeriaocdh. family at the time of student enrollment. In addition, see CCS website to access for de1tastilQs.uarter ………. October 3, 2016 2nd Quarter ……..... December 13, 2016 3rd Quarter …….......February 28, 2017 4th Quarter………….May 11, 2017 PROGRESS REPORTS Progress reports will be issued at the halfway point of each quarterly grading period. 1st QuartRerE…PO…R…T.COActRobDeSr 3, 2016 Report cards will be issued every 9 weeks. 2.nTd Qheuacrotuers…e e…xa.m....cDouencetsm2b5e%r 1t3o,w2a0r1d6the final course average. 3rd Quarter …….......February 28, 2017 4th QuarterN…ov…em…b…er.3M, a2y0161, 2017 January 26, 2017 March 30, 2017 REJPuOneR2T3,C2A01R7DS Report cards will be issued every 9 weeks. . The couGrsReAexDaImNGcouSnCtsA2L5E% toward the final course average. Letter grades: A: 90-100 November 3, 2016, B: 80-89 January 26, 2017 C: 70-79 March 30, 2017 D: 60-69 June 23, 2017 F: 59-below GRADING SCALE Letter grades: A: 90-100 ACADEMY OF ENERGY AND SUSTAINABILITY BTh: e8M0-t8.9Pleasant Academy of Energy & Sustainability (AOES) is a cutting-edge, innovative 4-year program designed to pCr:ep7a0r-e7s9tudents who are interested in engineering, energy systems, and sustainable solutions. With Charlotte outpacing the Dna:tio6n0-i6n9the creation of energy jobs, our academy is focused on bringing awareness and education of all types of energy Fso:u5rc9e-sbealnodwsustainable solutions. The AOES utilizes business and industry professionals, along with a variety of STEM 101 curricula to provide our students with hands on educational experiences, relevant information, and current technologies. This collaboration between education anAdCinAdDusEtrMy Yis OthFe dEriNvEinRgGfoYrcAe NthDat SenUsSuTreAs IoNurAABOILEISTYstudents experience work-based TlehaernMintg. PolpepaosratnutnAiticeasdtehmatyaoref Eunmeragtych&edSubystatoindabyi’lsiteyd(uAcOatEioSn)ailssatacnudtatrindgs.-eAdgOeE, iSnnstouvdaetnivtse w4-iyllebaer pinrospgirraemd adnedsigpnreepdatroed to pruerpsuareeaswtuiddeenrtasnwgheooafrceoilnletgereeastnedd cinarenergionpepeorirntugn, ietnieesrginy esnyesrtegmy sa,nadnsdusutasitnaainbailbiltey.solutions. With Charlotte outpacing the nation in the creation of energy jobs, our academy is focused on bringing awareness and education of all types of energy sources and sustainable solutions. The AOES utilizes business and industry professionals, along with a variety of STEM 101 curricula to provide our students with hands on educational experiences, relevant information, and current technologies. This collaboration between education and industry is the driving foAr/cBe tHhaOtNenOsuRreRsOouLrLAOES students experience work-based HleoarnnoirngRolplpworitlul nbietiecsaltchualtaaterde uant mthaetcehneddobfyetaocdhayg’rsadedinugcapteiorinoadl satnadndwairldlsb. eAbOasEeSd sutpuodnenatsstwuidllenbte'sinnsopnir-wedeiagnhdtepdrenpuamreedritcoal apvuerrsaugeea. wTihde AranHgoenoofr cRoolllelgweiallnbdec4a.r0eeAr vogp.p(oArt)u.niTtihees Bin HenoenrogryRaonldl swuisltlabinea3b.i0li0ty(.B). A student cannot have any D’s or F’s to be on the A/B honor roll. PROMOTION STANDARDS ANDAG/BRAHDOEN-OLREVREOLLCLLASSIFICATION Honor Roll will be calculated at the end of each grading period and will be based upon a student's non-weighted numerical Pavroermagotei.onTwheilAl bHe odnetoerrmRoinlledwfilolrbtehe4.t0otAalvngu.m(Ab)e.r oTfhcereBdiHtso. nor Roll will be 3.00 (B). A student cannot have any D’s or F’s to be on the A/B honor roll. Credits Needed To Be A 6 Sophomore PROMOTION S1T3 ANDARDS AND GRADE-LEVELJuCniLorASSIFICATION Promotion will be determined for the tot1al9number of credits. Senior TThraentrsafnersfSertusdtuednetnGt’sragdraed-Le ecvlaeslsCiCfilrcaeasdtsiiiotfsincNsaateiteodhneisd/her former school and an evaTluoaBtieonAof the student’s transcript will be used for grade placement and GPA. The GPA6of a transfer student will be based oSnopthheomwoerigehting system used by MPHS. 13 Junior PA19RENT ACCESS TO STUDENT GSReAnDioEr S Parents/Guardians will have online access to their student(s) grades and attendance. Additional information will be provided Ttoraalnl spfaerrenSttsuadsenthteGsyrsatdeem-LisevimelpClelmasesniftiecdathiornoughout this school year. Please contact the office for assistance if needed. T. he transfer student’s grade classifications at his/her former school and an evaluation of the student’s transcript will be used for grade placement and GPA. The GPA of a transfer student will be based on the weighting system used by MPHS. CABARRUS COUNTY SCHOOLS DROP-ADD GUIDELINES High Schools in the Cabarrus County sPcAhoRoEl dNiTstrAicCt aCrEe SonS aTbOloScTkUsyDsEteNmT. GThReAreDaEreStwo terms with four courses each term Plaasrteinngts/8G2umardiniauntesswpiellr hcalvaesso. nlWiniethactcheessimtoptlhemeirenstuatdieonnt(osf) gthraedPesowanedr aBttleonckdasntcued.enAtdsdrieticoenivael iandfodrimtioantiaolninwsitlrlubcetiopnrovdiudreindg toutaolrliaplarsensstsioanssthtoe seyitshtemr siuspipmlepmleemnetnotredenthrircohugchoonutet ntht iksnsocwholeodl gyee.ar.ThPeleNasoercthonCtaacrtoltihneaoDffeicpearftomr eansstiostfanPcuebliifcnIenesdterudc. tion r. equires a minimum number of seat time hours to earn a credit. As a result, if you miss more than 13 days in a course, credit might be withheld. Therefore, the following procedures are in effect for any student who requests a schedule change: 1. No changCeAs BwAillRbReUmSaCdeOoUnNoTrYafSteCrHthOeOfiLrsSt DdaRyOoPf-cAlaDsDsesGuUnIleDsEs LitIiNs EanS administrative error or High Schools in thefCorabpaurpruilsbCaoluantcyinsgc.hool district are on a block system. There are two terms with four courses each term lasting 82.minutes Apenrycsltausdse. ntWthiatht rtehqeueimstpslaemcheanntagteioonncoef tthheesPchoewdeurleBhlaosckbesetnudcernetasterdecineitvhee aSdpdritnigon(afol rinthsteruncetxiot nyedaur)ring tutorial sessions to ceaitnhemraskuepapnleampepnotinotrmeennrtictoh sceoenhteisn/thekrncoowulnedsegleo.r aTnhdedeNcoisritohnCs awriollinbae mDaedpearotmn eanctaosef -Pbuy-bcliacseInbsatsriuscatinodn requires a minimumwniuthmPbreirncoifpsaelaatptpimroevahlo.u(rCs htoanegarens atctrheidsipt.oiAntsaarerecsounlt,inigf eynotuumpoinssemxtoerneutahtianng1c3irdcauymssitnanacceosuarnsde, credit might be withheld. aTvhaeirlaebfoleres,ptahceef)o. llowing procedures are in effect for any student who requests a schedule change: 31. SNtoudcehnatnsgfeasiliwngillthbee fmirsatdceoounrseorofafatetwr oth-peafritrsetqduaeyncoef colfaassperseu-rnelqeusissitteiscoaunrsaedwmiilnl ibsetrdartoipvepeedrrfroormorthe fsoercopnudpciloubrasleancing. 24. ASencyonstdudteernmt tchhaatnrgeqesueasrtespaacrthiacnuglaerloyndciescthoeursacgheedduolnecheatshebesecnhocorel ayteadribnetghiensS;phroinwge(vfeorr, tthhee nPerxintcyiepaarl) cwainthmcaokuensaenloarprpeocionmtmmeennt dtoatsioeen hmisa/yhecroncosiudnesreeloxrceapntdiodneaclisciiorncusmwsitlalnbceems.ade on a case-by-case basis and 5. IwfiathstPurdinencitpdarloappsparocvlasl.s o(Cncheanthgesteartmthhisaspobiengtuanr,eitcoisntoinlgyenwtituhptohneePxrtienncuipatailn’gs acpirpcruomvasltaanncdesthaengdrade of WavaFilwabilllebseparecceo).rded on the student’s report card and transcript. The WF will be averaged into the overall 3. GStPuAdeanstsafafailiilninggthgerafdires.t course of a two-part sequence of a pre-requisite course will be dropped from the 6. sTehceosnedgcuoiduerslienes also apply to courses taken on-line or at a community college for dual credit. 4. Second term changes are particularly discouraged once the school year begins; however, the Principal with counselor recommendEaXtiAonMmEayXcEoMnsPidTeIrOexNcePpOtiLonICalYcircumstances. 5. 1.If a studen9tthd, r1o0pths, ancdla1ss1toh ngcraedtehesttuedrmenthsaws bilelgtaukne, iatlilseoxnalmysw, nitoh ethxemPrpitniocinpsal’s approval and the grade of 2.WF will bSenrieocrosrdareedroenquthireedstutodetankt’esarlelpEoOrtCc,arNdCaFnEd tarnadnsCcrTipEt.exTahmesW. F will be averaged into the overall 3.GPA as aSfeaniliionrgs wgrialldeb.e able to exempt only teacher made exams ( non-EOC/NCFE/CTE) if they meet 6. These gutihdelfionlelsowalisnogacprpitleyrtioa icnouarcsoesurtsaek(esn):on-line or at a community college for dual credit. a. Seniors must have an 85 or above average. b. SEenXiAorMs wEhXoEhaMvePTacIcOruNedPnOoLmICorYe than 3 (three) absences prior to the exam. 1. 9th, 10th, and 11th grade students will take all exams, no exemptions 2. Seniors are required tSoEtaNkIeOaRll EPORCIV, NILCEFGEEaSnd CTE exams. Seniors have the o3p.portunityStoenpiaortsicwipilaltebeinabspleectoiael xeevmenpttsoknnloywtenaachs e“rsemnaiodreperxivamilesg(esn”onb-aEseOdCo/nNtChFeEfo/CllTowE)inigf tchoenydmitieoents: 1. The seniortihsepfaoslslionwginthgeccroituerrsiea/pineraiocdo(usr)steo(sw):hich the event corresponds. 2. The senior has notae. xceedeSdetnhieoarsttmenudsatnhcaevpeoalnic8y5inorthaebocovuerasve/epreargieo.d to which the event corresponds. 3. The senior has paibd. all feesSoewnieodr.s who have accrued no more than 3 (three) absences prior to the exam. 4. The senior has not been suspended during the semester in which the event corresponds. 5. Teacher discretion (grades, attenSdEanNcIeO, mRaPkRe-IuVpIwLoErGk EduSe, behavior in the course in which the event Seniors have the ocpoprorertsupnointydsto). participate in special events known as “senior privileges” based on the following conditions: 1. The senior is passing the course/period(s) to which the event corresponds. 2. The senior has not exceeded the attendBaEnTceApoClLicUyBin the course/period to which the event corresponds. Students 3d.esiring Tmheemsebneiroshr ihpasinpathide aBlleftaeeCs louwbemd.ust: have a GPA of 3.8 or better, and have never been in ISS or out of school su4s.pended.TChehasnengieosrihnaesitnhoetrbgereandessusoprednidsceidpldiunrei/nsgustpheensseimonesteartuisnmwahyicehfftehcet eavsetnutdceonrtr’esssptoatnudssi.n this club. 5. Teacher discretion (grades, attendance, make-up work due, behavior in the course in which the event corresponds). ATHLETICS MPHS offers students the opportunity to participate in the following competitive sports: football, volleyball, cross-country, soccer, tennis, basketball, wrestling, swimming, basebalBl,EsoTfAtbaCllL, tUraBck & field, golf and cheerleading. Students desiring membership in the Beta Club must: have a GPA of 3.8 or better, and have never been in ISS or out of school suspended. Changes in either grades or dAisTciHplLinEeT/sIuCspEenLsIiGonIBstIaLtuIsTmYay effect a student’s status in this club. To be eligible for a team a student must: 1) Pass a minimum of three (3) courses during the previous semester at an approved high school. Student mentor and office assistant do not AcoTuHntLaEs TcoIuCrSse offerings and will not count toward athletic eligibility MpuPrpHoSseosf.fe2rs) sMtuedeetnltosctahleporpopmoortuionnityretqoupiraermticeinptaste(SineethPerofomllootwioinngStcaonmdapredtistiavnedspGoratsd:e fLoeovtbelalCl,lvasoslilfeiycbaatilol,nclriosstse-dcoaubnotvrey), sTohcecreer,atreennoitsh,ebrasckreittebraiall,fwor easttlainingi,nsgwiamthmleitnicg,eblaigseibbialiltly, soinftbaalNl,otrathckC&arfoileilnda, gHoilgfhanSdcchhoeoelrlAeathdilnetgi.c Association member institution. For a complete listing and explanation of each of the criteria, consult www.nchsaa.org. ATHLETIC ELIGIBILITY To be eligible for a team a student must: 1) Pass a minimVuImSIoTf OthRreSe (3) courses during the previous semester at an approved hTighhe sscchhooooll. Spotulidceyntismteontaocrcaenpdt onffliycethaossiestvainstitdoorsnowthcoouhnatvaeslceoguitrismeaotfefebruinsginseasnsdatwtihllensocthcooouln. t tAowLLardVaItShIlTetOicReSligMibUilSitTy RpuErPpOosResT. T2O) MTHeeEt OloFcFalICpErotmoostigon irne,qoubirteaminenatsvi(sSiteoer pParsosmaontdionbeSetsacnodratredds taontdheGirraddeestLineavtieolnC. laAsnsiyficuantaiountholirsitzeedd avbiosivtoe)r fTohuenrde oanre coatmhepruscrwitielrliabefocronasttiadienriendg tarethspleatsiscinegli.gibSitluitdyenints afroNmoroththeCrarsoclhinooalsHaigreh vSicshitoorsl aAntdhlmetiucstAbsesoacpiaptrioovnedmbeymbtheer iPnrsitnitcuiptiaoln. .StFuodrenatcsommapylenteitlhisetrinegatanludnecxhpwlainthatvioisnitofrseaocnhcoafmtphuesc,rnitoerrima,acyotnhseuyltrewcweiwve.nocuhtssaiad.eorfgo.od from visitors. LVOISCITKOERRSS STtuhdeesncthsowohl opwolischytiosstoraectcheepirt boenlloyngthinogses ivnisaitloorcskewrhmoahyarveequlegstitoimneatferobmustihneefsrsonat othffeicsec.hIotoils. thAeLsLtudVeInSt'IsTrOesRpSonMsibUilSitTy RtoEsPeOe RthTatThOis/ThHerEloOckFeFrICisEketoptsliogcnkiend, aonbdtain oarvdiesritaotr apllastsimaensd. bSetuedscenortstemd atyo nthoetirshdaersetilnoactkioenrs.. ASntuyduentasutahroereizxepdecvtiesditotor fkoeuenpdthoenirclaomckpeurs iwnilgloboed consdiidtieorned. Ttrheespaadsmsiinngis.traStoturdsecnatns cfroonmduocthseerarscchheosolosf aloreckveirssitaosrsthaenyddmeeumst abpepraoppprriaotvee.d Nboy othne should leave classes or the cafeteria to go to his/her locker without permission. TEXTBOOKS Any student who does not have their assigned textbook at the end of the semester will be charged the full price for the missing book. Students will be assessed a fee for any damages to textbooks that may occur. Students are strongly encouraged to place covers on their textbooks. STUDENT SERVICES The Student Services Department is available for every student in the school. The services this department provides include: assistance with educational planning, interpretation of test scores, occupational information, career information, study helps, help with home, school and/or social concerns, or any issues he/she would like to discuss with the counselor. Students wishing to visit a counselor should contact the secretary in the Student Services office to arrange for an Principal. Students may neither eat lunch with visitors on campus, nor may they receive outside food from visitors. LOCKERS Students who wish to store their belongings in a locker may request one from the front office. It is the student's responsibility to see that his/her locker is kept locked and in order at all times. Students may not share lockers. Students are expected to keep their lockers in good condition. The administrators can conduct searches of lockers as they deem appropriate. No one Pshrionuclidpalel.avSetucdleansstsesmoarythneicthafeerteraitalutoncgho wtoithhisv/ihseitrolroscoknercwamithpuous,tnpoermmiasysitohne.y receive outside food from visitors. TELXOTCBKOEORKS S SAtnuydesntutsdwenhtowwhioshdtoesstonroettheaivrebethloenirgiansgsisginnead ltoecxktebromokayatretqhueeesnt donoeffrthome stehme efrsotenrt owfiflilceb.e Icthisartghedsttuhdeenfut'lsl rpersipcoenfsoibriltihtye tmoisesiengthabtohoiks./heSr tluodceknetrsiswkilelptbelocaksseedssaendd ain foeredefrorataanlyl tidmamesa. geSstutdoenttesxmtboayoknsotthsahtarme aloyckoecrcsu.r.StuSdtuendtesnatsreaerexpsetcrtoendgltyo ekneecpoutrhaegierdlotcokpelrasciencgoovoedrscoonntdhietiiornt.exTthbeooakdsm. inistrators can conduct searches of lockers as they deem appropriate. No one should leave classes or the cafeteria to go to his/her locker without permission. TEXTBOOKS Any student who does not have their assigned teSxTtbUoDokENatTthSeEeRnVdIoCfEtShe semester will be charged the full price for the mThisesSintgudbenoot kS.ervSictuesdeDnetspawrtimllenbteisasasveasislaedbleafofereevfeorry asntuydednatminagthese stcohoteoxl.tbToohkessetrhvaitcems athyisodcecpuarr.tmSetnutdpernotvsidaerse instcrloundgel:y aenssciosutarnacgeedwtiothpeladcuecacotivoenrasl opnlatnhneinr gte, xintbteoropkrse.tation of test scores, occupational information, career information, study helps, help with home, school and/or social concerns, or any issues he/she would like to discuss with the counselor. Students wishing to visit a counselor should contact the secretary in the Student Services office to arrange for an appointment. Students are assigned a counselor baSsTedUoDnEtNheTfSirEstRlVetIteCrEoSf their last name. Assignments are as follows: A-K RThaechSetluSdeanutnSdeerrvsi,cLes-ZDLepyanrntmCernidt eisr.available for every student in the school. The services this department provides include: Pasasriesntatsncaereweinthcoeudruacgaetdiotnoaml paklaencnoinngta, citnwteirtphrethtaeticoonuonfsetleosrtsstchorroeusg, hoocucut pthaetiyoenaarl.inInfofromrmataitoinon, craergeaerrdinfgocrmaraeteirosn,,csotluledgyehelps, ahdemlpiwssitohnhs,ofminea,nscihaol oalida,ncdu/orrricsuolcuiaml cooffnecreinrngss,, otersatninygi,srseuceosrdhse/asnhde pweorusoldnalilkaesstoistdainscuesiss wavitahiltahbelec.ouTnhseelSotru.dent Services phone number is 704.436.3165. Students wishing to visit a counselor should contact the secretary in the Student Services office to arrange for an appointment. Students are assignedPaAcRouEnNseTlo-Sr CbaHseOdOoLn OthRe GfirAstNlIeZttAerToIfOthNeSir last name. Assignments are as follows: A-K RThaechTeIlGSEauRnAdeTrsH, LE-ZTLICynCnLCUriBdeorr.ganization works with all areas of the MPHS athletic program. PTahreenBtAs aNrDe eBnOcoOurSaTgeEdRtoCmLaUkBe coorgnatancizt awtiothn twheorckosuwnsitehloarlsl tahrreoausgohfotuhtethMePyHeaSr.baIndfoprmroagtriaomn .regarding careers, college MadPmHisSsiwoneslc, ofimnaenpcaiarel natisd,wchuorriacrueluinmteroefsfeterdinigns,wteosrtkiinngg, raescvoordlusnatnederps.erPsloenaasel acsosnistatacntcteheissacvhaoiolal bolfef.icTehife ySotudwenotuSlderlvikiceetso be apnhoMnePHnuSmvboelruniste7e0r4. .4Y3o6u.r31v6o5lu.nteer assistance to these organizations is both requested and appreciated Testing proctors are always needed by Student Services at the end of each semester to help with testing. Contact Student Services if you are interested in servPinAgRinEtNhTat-ScaCpHacOityO.L ORGANIZATIONS The TIGER ATHLETIC CLUB organization works with all areas of the MPHS athletic program. The BAND BOOSTER CLUB organization works with all areas of the MPHS band program. MPHS welcome parents who are interested in working as volunteers. Please contact the school office if you would like to be an MPHS volunteer. Your volunteer assistance to these organizations is both requested and appreciated Testing proctors are always needed by Student Services at the end of each semester to help with testing. Contact Student Services if you are interested in serving in PthOatWcaEpRacBityL.OCK AND TUTORIALS POWER block takes place between the times of 11:35-12:49. It is divided into two sections POWER A and POWER B. Each section lasts for 35 minutes. During this time students are expected to eat lunch and to attend at least one tutorial daily. Requirements: 1. Students are required to attend at least one (1) tutorial per day. 2. Students are required to aPtOtenWdEatRleBaLstO2CtuKtoAriaNlsDfoTrUeTacOhRoIfAthLeSir teachers during a three week period POWER block takuenslepslasctehebyethwaevenotvheer taim90esaovfer1a1g:e35in-1a2:c4la9s.sItthisenditvhiedyedarienteoxetwmoptsefrcotimontshaPtOteWacEhRerA’s atuntdorPiOalWs ER B. Each section la3s.ts for 35Stmudineunttess.mDauyribnrgintghilsutnicmhetostuadcelnastsraoroemexfpoercatetduttoorieaalt lunch and to attend at least one tutorial daily. 4. Students are required to attend mandatory tutorials as assigned by the teacher Requirem5.ents: Students must attend a teacher’s tutorial if they have under a 70 average in that class 1. Students are required to attend at least one (1) tutorial per day. Purpose:2. Students are required to attend at least 2 tutorials for each of their teachers during a three week period 1. uTnhleespsutrhpeoysehaovf ethoevperowa e9r0balvoecrkatguetoinrialscliasstsothperonvtihdeeysaturedenxtesmwpitthfraonmotphpaotrtteuancihtyert’os gtuetoorniaelson one 3. aSstsuidsetanntscemwaiythbtrhineigr ltuenachetros a classroom for a tutorial 24. TStoudalelnotws aareplraecqeutioresdtutodyattend mandatory tutorials as assigned by the teacher 35. TStoudalelnotws mstudsteantttsenadveantueaecthoebr’usiltdutroerliaatlioinf stheipyshwavitehuthnedierrtaea7c0hearvserage in that class 4. To allow students to make decisions on where to go thus allowing them to grow in their decision making Purpose: process. 51. Thoepprouvripdoesea opflathce apnodwteirmbelodcukritnugtotrhiealsscihsotoolpdraoyvifdoer sintutrdaemnutsrawlisthpoarntsoapnpdorctluunbitmyeteotignegtsotnoetoakneopnleace 6. aTsosipsrtaonvcideewsittuhdtehnetisrctoeamcphuetresr access to work on projects 72. To palrloovwidae pAlaCcTe tporesptuadsysistance 83. To palrloovwidsetuodpepnotrstuanviteineusefotor sbtuidlednrteslatotiomnesehtipwsitwhitshchthoeoilrctoeuacnhserlosrs 94. To palrloovwidsetusdtuednetsntsowmiathkeredaedciinsgioansssiosntawncheere to go thus allowing them to grow in their decision making process. 5. To provide a place and time during the school day for intramural sports and club meetings to take place Just Do I6t.: To provide students computer access to work on projects 71. TJuostpDrooviIdTeiAs CouTr pbrueiplt ainsstiasrtadnycreecovery session. 8. To provide opportunities for students to meet with school counselors 92. TStoudpreonvtsidwehsotuadreenttasrwdyitthorcelaadsisnwg ialslsailsstoanbceeassigned a Just Do It in order to make up the seat time 3. Just Do It sessions are assigned by administration or teachers and last 35 minutes. 4. Just Do It sessions take place during POWER A Just Do I5t.: They are in a designated area set by the administration. 61. FJuasitluDreotIoTaitsteonudrabuJuilsttiDn otaIrtdsyersescionvewryillseressiuolnt .in further consequences set by the administrative team POWER2C. ell: Students who are tardy to class will also be assigned a Just Do It in order to make up the seat time 13. PJOusWt DEoRICt seellssisiodnessaigrneeadssfiogrntehdosbeysatdumdeintisttrhaatitohnaobrituteaalclyhemrsisasntdutloarsita3ls5amndinsuktieps.Just Do It. 42. JPuOstWDEoRItcseellsswioilnlslatastkefoprl7ac5emdiunruintegsPOWER A 53. TSthuedyenartse ainreaedxepseicgtneadtetod bareeqausieett bdyurtihnegatdhme iPnOisWtraEtiRonc.ell and are expected to be working on class work. 46. IFtawiliulrletatokeatptleancde aduJurisntgDbootIht sPeOssWionERwiAll arensduBlt in further consequences set by the administrative team 5. Students who habitually skip tutorials will be placed in the POWER cell by administration POWER6C. ell: They will be released from the POWER cell when they make academic progress and can prove that they 1. PwOillWaEtteRnCd etulltoisridaelssiognneadrefogrultahrobseassitsudents that habitually miss tutorials and skip Just Do It. 27. PSOtuWdeEntRs wceill weaitlllulanscthfoinr 7th5emPiOnuWteEsR Cell 3. Students are expected to be quiet during the POWER cell and are expected to be working on class work. 4. It will take place during both POWER A and B 5. Students who habituallyCsRkiEpDtuItTorRiaElsCwOilVl bEeRpYla(cYedEiSn CthEeNPTOEWRE)R cell by administration General 6G. uidelinTehs:ey will be released from the POWER cell when they make academic progress and can prove that they 1. wOidlyl sasteteynwd aturetoarniadlsNoCnVaPrSegaurlearthbeaosinsly approved platforms for credit recovery 27. Studdeennttsswmilalyeantoltucnocmh ipnlethtee pPaOcWkeEtsRoCr etlelacher work for credit recovery 3. Students should be enrolled in credit recovery within two (2) consecutive sessions following a failed course 4. Students failing with less than a 50 and or a non-passing/non-proficient score on the final exam must retake the course or use NCVPCSRCEreDdIiTt RReEcoCvOerVy ERY (YES CENTER) General 5G. uidelinSetsu:dents failing with a grade between 50-59 and or a passing/proficient score on a final assessment are 1. cOadnydsisdeaytewfaorecarendditNrCecVoPveSryarveiathOe donyslyseaypwpraorveed platforms for credit recovery 26. Stuuddeennttssmmuasyt cnoomt pcloemtepclreetdeipt raecckoevtesroyrinteoancehesremweosrtkerforrscersesdioint recovery 37. Students mshuosutldfoblleowenarollllYedEiSnccernetdeirt ruecleosvwerhyilweittahkinintgwcore(d2i)tcroencosevceurytivaendsemssaiyonbsefroelmloowviendg farofmailecdrecdoiturse 4. Sretcuodveenrtys faoirlivnigolwatiitnhglethsse tYhaEnSaC5e0ntaenrdoor rscahnooonl-rpualsesi.ng/non-proficient score on the final exam must retake 8. tThheactoduercsiesioornuisethNeCsVchPoSolCardemdiitnRisetcraotvioenry’s decision using feedback from the YES center coordinator 5. Students failing with a grade between 50-59 and or a passing/proficient score on a final assessment are candidate for credit recovery via Odyssey ware 6. Students must complete credit recovery in one semester or session 7. Students must follow all YNEOSNceDnItSerCrRulIeMs wINhAileTtIaOkiNngPcOreLdIiCt rYecovery and may be removed from credit Cabarrus County SrecchoovoelsrypfrorvivdieoslaetqinugalthaeccYesEsSaCndendtoeersonr ostchdoisoclrirmuliensa.te on the basis or race, color, national origin, sex, sexual or8ie.ntation,Tdhiastabdielcitiysiornaigsethien sitcshporoolgardamisnoisrtraacttiiovnit’isesd.ecTishieonfoullsoinwginfegepdebrascoknsfrhoamvethbeeeYnEdSesciegnntaetrecdotoordhiannadtoler inquires regarding non-discrimination policies: 504 Coordinator – Nancy Jones 704.262.6117 or nancy.jones@cabarrus.k12.nc.us NONDISCRIMINATION POLICY TCiatblearIrXusCCoourdnitnyaStocrh–ooLlsynpnroRvihdyems erqu7a0l4a.2c6c2es.6s1a1n5dodroleysnno.rthdyimscerri@micnaabtaerorunst.hke12b.ansci.suosr race, color, national origin, sex, sexual orientation, disability or age in its programs or activities. The following persons have been designated to handle inquires regarding non-discrimination pNoOlicTieIFs:ICACION DE NO DISCRIMINACION Cabarrus County Schools prove acceso equitativo y non discrimin en sus programas o actividades sobre la base de raza, c5o0l4orC, ooorirgdeinantoarci–onNaal,nsceyxJoo,noersien7ta0c4i.o2n62s.e6x1u1a7l,odrisncaanpcayc.ijdoandeso@ecdaabda.rrLuass.ks1ig2u.niecn.utses personas han sido designadas para manejar consultas relacionadas con las politicas de no discriminacion: Title IX Coordinator – Lynn Rhymer 704.262.6115 or lynn.rhymer@cabarrus.k12.nc.us 504 Coordinator – Nancy Jones 704.262.6117 or nancy.jones@cabarrus.k12.nc.us NOTIFICACION DE NO DISCRIMINACION CTiatblearIrXusCCoourdnitnyaStocrh–ooLlsynpnroRvehyamcceers7o0e4q.u2i6t2at.6iv1o15y onronlydnins.crrhiymminere@n csaubsaprrougs.rka1m2a.nsco.uasctividades sobre la base de raza, color, origen nacional, sexo, orientacion sexual, discapacidad o edad. Las siguientes personas han sido designadas para manejar consultas relacionadas con las politicas de no discriminacion: 504 Coordinator – Nancy Jones 704.262.6117 or nancy.jones@cabarrus.k12.nc.us Title IX Coordinator – Lynn Rhymer 704.262.6115 or lynn.rhymer@cabarrus.k12.nc.us Mt Pleasant High 2016-2017 Parent-Student Handbook Principal: Mr. Jon LaChance Office: 704-436-9321 Fax: 704-436-3179 www.cabarrus.k12.nc.us/mountpleasanths

[close]

p. 2

WELCOME The administrative team would like to welcome you back to school for the 2016-2017 school year. We are excited to have the opportunity to work with each of you and look forward to a successful school year. eTTttWahhxchheetpeeeievoowaarippitddoppeimmeunooslcrriid.nntteuuii.lInnssitkttiirrwtteaayyitttliittolvvoobeecwwehtteeaootaahlrrlmmkkreonwwuwwggiieootthhhuueyllaeeddocaauhcclliirhhkkoheefooaffyttrooyyodoouwwwuuteeoollaarccnnpkooddummatllneeoofdoooyyrkkooothvuuffeooybbrrroawwaulcclaarkkWWrrcbddottEEeoomttsooLLsstmccaaCCehhiftssOOoofmuuoooMMccrlletccnffEeeEbootssorrtsshtfftthauuhhtlleeinyss22ccot00hhhu11ooew66ooc--llil22layyl00seea11saacr77rroh..ossieccmvhheooaoonthlldeyyieeunaalrrtyi..omuWWarteeexaahtrrireegah-eecxxsuccriihrttioeecddoullttaoorhhaavvee eeTWJMtWaahoxxcchenattppeeeiireevvowwLkarriipliittadioopeeiisCKmeeuunnohssllhiccridd..eyntaeeusoni..llIInsiittuckktirewwteeaayiiltttlllitoollvothbbeccweeehhteaaottbahhllrellmkrreesoonntwuuwggaggineeothhhdueeyylaaedooccaruuhheclirrhhkoohheeffoaarf--yyterroyooddtouuwowwuttesoooolaurrcnppkkodpuumaaottlnneorffddtoooyyrrkooottohhvvufueeoyybrrriooaawnaPAuullcrllaosrrkWirsccnnbbdiootcesEeeommittsspooaLsttmmnfacaCeelthtiiffhttsOPoffmmueooroMcirrleebnttcnnefcEebbottsisootrpttshhttatfthhiaauhlmttleiinnyyes2scoott0hhhuuo1oeefww6occy-liill2ollaayll0usseaa1rssaccrr7lroohhi.foosiieeecmm.vvheeoaaonntthhlddeeyiieuunnallrttyyii.oommuuWaarrtteeeeexxahhttriirreggaahh--eccxssuucccrrihhrrtiiooeccdoouulllltaaorrhave WWLWaeeerrwwwyiioSssuhhulldyylioovliuuakneaalltllotthhceehabbleelessntt gaanneddeaaacrrhee hhoeefrr-yeeottuoo tssouupppppuoot rrfttoyyrtoohuuyiionn(Au9oosr-snnbi1eeset0sooa)tnffetttfhhPfeeorirbbnteecbssiottptatthiilmmineessthooeff cyylooauusrrsrlloiiffoeem.. and in your extra-curricular eJJMMaooxcnnaatpirrevLLkkrillitaaeiCCKKenshhiic.eeaaessnn.Itcceewill be through your ha--rd -- work and overaPP(l1rrl1iicnno-ccmii1pp2maa)llitment that AAssssiissttaanntt PPrriinncciippaall you will achieve the ultimate high school tWJLLFIhnooaaenerrlrriswLagyyuhairvSSsteCahuusorhtllifyllaewiionttvvhyuacaaiyennosaftlfolartecghatee,stowbtnheessetermnaanncoodgsuitanruragepgCf-hertoeoAyr-m---oBeduaAtitonteRocsslRupecpmheUproeSiooonrldCttciywOcaoaleUuelalnNtyihdnP((AA((Tr9911aereossrr11iY--ssvnntiiii--n11ocesseSitt0011fwpolaaCo))22ennfargH))mltttthihPPsOaeelrrtaOiiisbtnnocieLnccvhsii.eotppCoraatieAlllmqcLueaEislreNeonmfdDyaeAornuRtosrn,2lltiih0fnee1e.6sa-c1th7woowl wca.cleanbdaarrruiss.ks1u2b.jnecct.utso. change. This is ttSIMLcFFOIIhhmnnhcooaueeaahrrrpllrrrniissooaakggywuunorlhhrrvvetlSetteeKasaalbussnoorrhis2ttliitefflioee1wwitssttttvme,hhyycaaaTahiieyynoossdpowffttdaffoooiaarrrglteeccetggeeaaettsee,,rsssvltt,ioowwesittnnCshhteeessteeoldsieenrrsmmnnaaawntennccbooeidooggosscluuliittvtonnrreuubnEaagg.ppeggdtCCff--hee,rrttaooeooAAntyy--hmm--nfooBBddreuuoaaoAAiiuttsnnntteeRRncootcchcssllcRRppeeccoommhhdeeUUovrrooleeeSSiidoooonnrsalliddCCttoigcciilwwfOOnccyaaaat.lleeUUheeallaallnninNNttyyTshhdddA(A(TThhrr91aaeeeesstrrrrea1YYhs-svvnttiiiieii-Inn1oossdeeSSntt01ffbMwwllaaCCdoo)2eeonnrreggHH)PommttttphhiikHPePssOOaaee,llnrrSttaaOOaiiiidssttnnooncciiewLLnnccvvhhdnii..eeeootppCCtboohrraaTseeAAlllleirqqrtccLLieeuubaaEEiilluiarreesnNNeernneammeddDDl,saaeeAAotrrlnnhsRRttooaessnn,,l22eCllittiinxhh00nnhkcee11eeae66rtsslaaol--cclo11ttehhotn77wwtoouetoorwwsllOsowwcciubtaa..erccsllceeaafennrrbbsvoddaaemaarrorrrrrf,uutiihssTss..cekkisshm11uuCo22bbeao..jj-bnnleeWaccccirtt..naruuttfrussooons..reccmCrTThhoaaahhcutnnaiiissnboggntleeiiyess... tSSIIccFOOIhmmnhhccouueaahhrpplrrnnisooooagwwunnoorrhrveettlleeteaassallbbTsnnorhhss22tittifiiooe11mwttssttmmee,,hyccaeTTaahhieeyosddppoowwftddaafoooiiarrrgglltteceettgeeeeaeetsse,rrsssvvllt,,iioweessiitnCCnnsshtteeestteoollddssiiennrssmnaaawwnntteencbboeeiiddogoosccllullitvvttoonreeubbnnEEag..peegddttCf-hhe,,BrtaaoeeoAnnttyl-hhmonnffoBdrreecuooaooAkiuutssnnnteRnnccottchhccslccRpeceeoooomhddeUoovvrolleeeSiddoonrrssaaliidCtooiiggcillwffOnncyya2att..leUhh0eaalalnnnii1NtyTTsshddd6Thhhhrae-e2ttrreeaaYhhvnn0tieeiIIno1ddeSnnf7bbMMwlCddoeooreeBgHPPoomtpphiekkHHeesOale,,lnnPlSStaOaaiddsSOtonncieewwcLnvhddWnnh.eeeottCettbbohhErdTTsseAleeRiiurrqrrttcLiileeeeubbaeEiluuiiaaressnnNerrneeaameedDll,,ssaaaeAoottrllnhhssRtoaaooeesn,ll2eeCCliitinnxxh0nhhkkcce1eaaee6rrttsllaooll-clloo1teehoottnn7wttouueettorrwTsslOOssoowiciimuubbtta.eerrcsslecceeeaffseenrrrrbssvvoodaeemmaroorrrrff,,uttihhsssTTs.cceekiishhmm1uCCoo2beeaaoo.j--bbnlleWWaacciirrt.nnaarrutffrruusooonnss.rreecmmCCrrThooaaahccuuttnaaiiisnnbboognnttlleiyyees... S111IcO7877mh120cu::::ah:::1141pr305no5155o359wnor––––etle––-aslbTT8188n211hs2::0:tiii12o3331mm1:t::sme0777,534cee5Tah91edpowdaoirglteteeesrsvl,iesiCnstetoldsinsawnt314P121ebeidsnrtssoohcltttddlwvtBBBoBBebnEelll.lloooeroodtccchcc,BBakkkkekntllhoonfreccookkusnncthcceoodovledrsaioiglfny22t.h00ani11Tsd66hh--22teahn00eI11dLn77bMduoeBBnPopeeckHellh,nPPllS/adSSOOtnuewccdWWnthheoteetbrhEEddTsieaRRiuurrtillleebseeuiasnreael,saotlhsaoe Charlotte Observer, Time-Warner cable excellent sources of school information. liPnkowtoerouArTTs1iiimm1te:ee3fss5ro-1m2:t1h0e Cabarrus County Power B 12:14-12:49 88::4411 –– 1100::0055 1100::0099 –– 1111::3311 22nndd BBlloocckk 2016-2017 Bell Schedule 33CrrddABBBllAooccRkkRUS COUNTY HIGH SCHOOL ATTENDANCE POLICY 1111::3355 ––T11i22m::44e99 PPoowweerr BBlloocckk LLuunncchhP//OttuuWttoorrEiiaaRllss PPoowweerr AAT11im11::e33s55--1122::1100 C11722a:::1b55a533r–r--u822s::311C755ounty policy s441tattshhttBeBsllootcchkkat more than thirteen (13) absences in a high schPPoooowwl eegrrraBBd11es22::(11944---111222)::44c99ourse during each 1sH8e0:am:4n01e9ds–bt–eo1r1o0i1ks::03cf5oo1rnstihdeerleisdt eoxfca32eCCbrnsddAAssBieBBBvnlleAAooccaecRRknskRRdwUUshtSSiucdhCCenOOatrsUUewNNaipTTllpYYnrooHHtvIIerGGedcHHeaisvSSeeCCxccHHrueOOsdeiOOdt .fLLoNrAAtoTThteeTT:cEEFoNNaumrDDsieAAl.yNNPvCClaeEEcaastPPeioOOsneLLseIIatCCrheYYenCoat bexacrursuesdCaobusenntycePs.arent CC11ssrHHWotaeec21aaraaammch::dbbsnn35ueyaaeeo35ddrnrrssn+rrbbtti–-eeuuanfoorrn2oss11ooa:rii2kk1aCCsscc:tb5hh4ccoooffseooeoo9uuuecrrnnnnraksssttttbc-eyyiihheisddneeeweepponrrllh+ooceeciillesscddeii2ttnucc.eeooryyActxxsffhh,ccsseaa4PepeeCttsrcbbaatassotehAkuttssrssweeBeiiaee-dBvvssnoernneleeeuortAnccttcthhnaaeetaBRsskaannssotl=ttRddtmoowwetcmmUss1uahhmkttlsSooiiuuacctaorrddbhhCyeefpeesrnnOfeaanttootthhnrrovssUuaaeectirwwnneNdbaa.oeiieppTttllNfhhllppasYaiinnourrrrnntoooofttHeeeyfottvviseetIceerroennGeeaiddfeccrfHn((eteeaar11hoLtiissvva33emSdueelee))sCofnxxooccaaccHclrrubbuulhreepomOssessdd/aeewqteeiieOrnnudduttiencctni..ffLntoreeoogaterssNNrr/t:AdgiiatttoiioouThhannflnttaorseeeeTdrr::taadccEioFFelooiahhaNseaauutn,iixmmerrDgg,csschhiiceehAudllh..eyysossNecePPccvvckCthhllPPaaaokee-oonEcciooraanooaai,wwssnasllttPeeciibeeooaoOaggsrrsnnunerreLaaABdssrndeetdd/Icaaottc1Cee1eorrhhrhss2.ee1fYeeec::Nnnl((1ch3CCa99ooko45ew--aattt--c-11eo1,bb1eek22:u2xx2aae))oAt:cct:rrs4cu1urrccn..9t0ssuuoo,seeauussP.dddbrraCCosssFraaceeeooeobbunnuurssddmcteenneuusennettxrrmyyccnmiianneetmaPPaissggny..yaapgeerrlaaeaaeetll:hccsnnshhoo1ett CaaaasarrrpppHSSSWWWcooodddtttaaaeeeerccccbccchhhaaatttarrraaaaemuuuccccsccchhhyyyooodddbdsssneeeeeddduuueeennnyyyaeoootttissssndeeerrrnnnhhheeetrsnnnsssscnnn.+++rbtaaaiiiefffeuaaatttnnnOttttffftttorrrssshhhhsrnnnooos111ooootttnaaaeeeerrrhhhwwwimmmakaaacCsccceeeccctttwwwwhhhebbbhhhhhyyyccooooftttooossseeeeeeeoeeeoohhhtuuuueeewwwhcccbbbbrnueeenrrraaannnhaaakkkessssssseeensrrrttbbbcccaaaaiiii---eeeyieeerrrhcttttteeeiiivsssdttteeeeeeynnnottteeeewwwettteeeep-ooouaaannnttttttrwnnnlhhh+++aaaooooorrrmcccnecccidddrrrdddleeesicccdeeetidddddd222oaaatnnnyyyyuuuc...yyynnnerooooeorrryAAAcccctttttte...xcccccccsssfhhhooohhhoc,,,TTTuuuueeecsteeeaomeeepppehmmmmccctssshhhrrrcccmcccbaaaaslllttteeeaeeemlllaaakkkuuutsrrreeeeseeenemeeeisssaaannnne---dddtttrrrivsnnnsssooouuurrrtnkkkeeetttttieteeehuuuttttttnnn...cewwwtaaaaoootittthnnnaeetttaaaennnnrrrrsssiiisssanstoooeiiilllddddhttteaaalll===tdtttmmmoooweallleeewaaaaaaatttmnss111llluuuaaahllllllmmmioooteeeesssllllmsssoiu(cccrrrrloooaaactttaaa1ooordttttaaabbbahhyyye3fffpppbbbetttoooodsssiiierrr)neeefffeeannnuuuuoooetoooaooothnnnrarrrrnnnooorrrrvvvsauuuaecccbeeetttaaaaiiirrrwwwwaneeeqqqdddsdbbbttttat...ettttooouuueeeeiiiiteeepeeeenllltleNNNfffciiihlllnnnnlpaaarrrncsssiaaaieeebbbddddnooosuuuredrnnnnnnidddeeeaaaatttosoffftaoeeeeyyyfffnnnnoootvndddntttiiissswetttccccooocccercoooeeeeeeneeeeeaaaiiitidetttfffeeehlmmmceeerrrffflccccnnn(eeettteearrrrrra1llllhhhaaa***looommmtttis*eeeeposvaaakkk3***eeemmmdddrrrrpc*sellliiieeee)***kkkksssnnnooohfffee*x***oooooocuuucccaeeeoaaaa*cttttlllc***ruuuoooodddlpppbou*lllrrrserppp***ooommmsleee*se.daaaabbbtttaaa***ewwwqqqemdhhhiyyyeeerrrnssssduuutieeeiiiOeeennncttttatnnntttiii.fnnnuuuuttthhhrrreyntttogggiaaatttiiieeeddddsneeelNr///mmmttt:::ndddyeeeegggiiitssstttoooiootnnnnuuueeehaaanhcccfffinnnttttttaaaooorrrnehhheallldddrrrgaaaarrrooo:ttttaooodddciiioooobbbbesssoooFeeelllcoiiixtttssssaaahaaalllsssoaeeeaueeee...ttttnnniii,,,ixxxgumreeernnnngnnn,,,ecccscccarhccccimcccehhhsuuuidddcccleeeenehhh.eeeylllsssooo....seaaa.seeeccceeePccccvtsssccckkkIFFFFttthclaaasssafooookkke---iooooonnnciiirrrrradddtnnnollllaciii,,,hsrlllluuunnnaaassslutooooeeecccirrrbbbmovwwwwaaaoooiiiaaagsssssnnnnnnneuuunnneeeretsgggrauuuuudddsrrrnnndddtesatttddpppp///cccPPPaeooontccceeeeeooorhOOOrrrtttthhhctsn...efffooooheeeeecccWWWtNNNnalll(sccchhhooooCaaa9htokkkoooeeennnnEEEwwww-aatdttt---ccc1----RRReeesooo,,,bieekkkllll2l:::uuuiiiicxaeeeflnnnn)bbboooiAAAotttctttrsssseeeetlllcccuuuuurhciooonnn......otttrsueeeeoe,,,cccssstenxxxxaaausPPPkkke...ddddc.bbbccccreaaaCoooosuuuussstttFFFnrrrauuuccceeeemssssoeeeooobuuutttnnneeee(nnnurrrooosmd1mmmsssscccttterrrneeeu4ssseeeiiiniwwwweeetxxxaaar)tmmmycnnnmmmtilllaaaiiiienoessslllltttmmmaaaPellllaaaiiisgrnnnoooyyy.yyyabbbbpppmggggnnnereeeelllaaaaaareeeaeotttatttllllll:::bbbbhhhchhhsssnsssrnhoooyyyyooo111eeeeeett aatpSbccdMuSSerrbbehantttaeeuuussyaouceddeedddknshxtiinneeeuhetteecccn..nnaa-reeeftttOOUl’tressssssoctdnnphwwwimraaeccruedWcheehhycclut.oooeoohttmowhhsuueahhreeaennsraakatnerccttvvateyyoodt-neete--uuatwwcneSarmmnnexdrdtiittsduddooapyyy,ydneerrescctee.eccotooccntTeuttaoommhhtcdhctsmmliaaeemmlaoennnmmmsntriitsuttkusttsiitthhttt..eeswoattiiteeeerrrriTtteeimlhheealheeeaalwwaeannxsslkliiopasllmme((cllofe11fauaachhe33bttddpciee))eoeetaadweaanrrraadbbetowaaoqssddrttteeueekittcnnleeccaiolrnnccfiicmebssoeeddhiiderssaaoopennrdnnatlww(oecclesltttiieet)hhellmealleeroaamba*llm**rppoosssk*appcc**essaie*knhhneeee**n*euaaeooc**cc*-adllpeoo**ussrr*dsll**ee..pbt,*mmmddhyewiieOOiaattvntohyynnteiiiirnnsellmnnktyyrsootteawhhciitttnnhaaloohggottorseooesoeccnmxxtlooaa.ttdirgguurunueeaarrstemmssiitcunneelrgteea..ssonittsIIviccsffnooseiiurrrrgdttccphhsrrutuupeeeeormmrevvimssnnseettsscgrrsuuitthssiaaddoPeesonneeniOoccttonnshhleenWtt.aassahhttfcEWwwoaaddcRrssoiieeillcctrtffllhbhdiioossttlieuuhhiieonoorrxeemcgttnnckeecc..ateeooktpnnummetttih-((oommu11ernp44iiica))ttmplttlaeeoosesaeerrrosdirmmggoneorrdoooaatfhorrnnmtoeeertt S((((SSSSattttTTTTbbbTTTTcaaaattttMMMuuuPPPPShhhhheee4444rnnnnbeeennntttttaaaathhhhrrrraaaeeeeeeu))))ueeeesaaarrrruuueeeeuuuu,,,,ccceedAAAAedppppdeeeekkkfssspppphhhxxxnnnnaaaainnnnnueffffessssuuuddddteeerrrreeeccciiiinnnnoooonc.ttttnliiiiaaammmmrrrr---ttttrrreeesssslttttooooeccccttssssOUUUllloooo’’’eeesdsyyyyrrrrrrrrttttiiiiwwwwsssdcccdddnnnnnpppeeeerffff////iiiiwriiikkkkrrraiiiiiooooiiiieeettttiiinnnncrrrolllluuuvmmmmuuussssnnnndddWWWcccllllellllhccccpttttclllellllrrrruuuoooo...rrrriiiibbbboeeeooooppppnnnno-tddddaaaawwwwmmmoooahssseeeeowwwwiiiiurrrrtttteeeehnnnnnrrrefiiiillllooooaaansssnnnniiiivvvvfaeeeekkkggggdnnnnwwwwtttnnnppppcttttteeeeddddvaaa444ayffffodddeeeettttdhhhhsssnnnllllAAA22223333---nnneooooggggoooon...oooo-aaaa....urrrrhhho........eeeeffffooowrrrrccceeeedeeeAAASSSsssslllmnooommmmcccceeennnnllltttccccssssxxxntttttttiIIIIUUUUHHHHooooeeetllllpuuussssssrrrriiiiuuudhhhhnnnopppffffyaaaaoeeeegggguuuukkk,,,aaaasssffffilllppppaaaadddereeeeeeeooossssddddtcdddaaaannnnaaaabbbbssscevvvvoooossssyyyyaaaeeecccccccwwwtttksnnnnttteeeeocssssccccooooeeeeeeennnnnnntttlllkkkkooouuulllt-pppptddddcccclllaaaeeeeiiioiiimaaaaosssffffuhtttuuuuddd----lllsssrrrryyyyyyytttnnnnrrrrssstttllllmpllliiiipaaaaooooIIIItttiiirrrraeeemmmlllleeeeeemoooonnnnttttoooSSSSnttttnnnwwwwmmmmmmmaaannntttmiiiiiuuuuyyyppppitttt////nnnuuuuffffuuussssSSSSniccctttseeeeiiiioooooorrrriiiitrrrraaaappppuuussstsssrrrrmmmmissshhhnnnn....lllltnnnnhtttuuurrrrinnnnoooot...fllllppppettttssstttaaaneeetddddreeeeoooollllirrrppppmmmmttteAAAAebbbaaaarrrrryyyyorrrrrrbbbttttnnnnaaaaTTTtttteeeetterrrreeerrrrsssoooommmneeennnhnnnnnnnnttttheeeerrrraaaaeeeesssshhhoooosssssssstaaafffeeeeaeeeeccccyyyyssssennnnuuuuwssssaaacccc,,,,eeeppppaaasssooommmnxxxccccccccseeeeottttllllkkkuuuhhhhcccrrriiiifffffieeee((((tttthhhheeeepppaaafnnnnrluuuumeeecccc2222qqqqccbbbeeeoooo(rrrriiiimmmlfffoooooeeeiiiitssssaaaa1rrrrvvvv,,,eee))))uuuuoooonnnnfffmmmhuuuacccoooonttttttttcccchlllleee3eeeepppaaaaaaallllrrrrhhhhdddllllaaaatttdepppllllhhhhtccc::::rrrreddddiiiuuuukkkrrrreee)ttt,,,,eeeeaaannnntttteeeeettttttatttteeedeeee,,,,dddscccchhhheeerrrrwwwtttbbbbttteeeeeeeaqqqqSrccccdddcreeetttteeea---ttttaaaaeeeedddrrrrrrrbcccciuuuueeeettthhhhkkkkhuuuoooTsssddd...lllliiiibbbbavoooslllldddddyyyynnnniiiisssseeeeoppprrr----tttaaaassssterrrreUooocccceeee,,,,kkkooootwwwggggcccoeeeeeeeessssPPPbbbbwnssssehhhhaaafffcaaauuuuaaaaoooDsssslnnnnddddccccyyyyrrrniiicfffttttsssiccc.oooonnnnattttmmmtttaaahhhhhhhheeeccccsooottttssseEdhhhooooaaaahhhTyssssddddrrrrisssbbbeeeeiiieeeeoooorrr----saouuuupppeeettttccccllllggg.eeeiiiNhsssoooottttnttttnnnrrrhhhhAAAAnaaaooooaaaafffflllnnnnnnwooooeeeeeeehhhhillll(((eeerrrrTPclllnnnnrrrroooonnnnstttmmmnnnffffsssooooeeeelllfffttttiwwwweiiiifffflcccccccoooo)))hddddeeeiiilcccyyyywmmmmtttggggeiiiiDaaavvvleeellllyyyyhhhllllaaaaiiiicccceeeeoooaaaaaaiiiimmmbbbnnnlllleeeiwwwwlnnnneeee(((eennnnppppRllll*rrrspwwwwlssssosssstttaaaassslcccceeeeeaaassss(((aaaaiiiissspc*eeeccccpppp)))saaaOnnniiii555lllleeeearrrrkkk...,,,llllhccccnnnooooee*llllnnnrrrrllllNttttooossss)))lllllrrrreeelllliiiiPannnnnnnnoccc*ttttsssloooobbbbtttaaaaoooouuuuc---ooooorrrrdddaaaolpppeeeeeeoooootttt*-nnnneeeeuuussssseeeerrrrraaaaaaaadddtwOsssaaaleeetttt*sssse.ettttnnnnssssnnnnpppccccttteeee,,,tttmmmccccccchhhhyyymduuuu:ooooooeeeeccccFttttoooowwwwiiifeeeaaaawwwsssffffillllllllOTiiifffyyyyoyyyynnnnFrrrratttttvvv9999ttttnnntttiiiiiiiooo((((rooooooohhhhoooocccytttttttneeeiiiiiiiiii/icccc5555hhhhfffaaaaAAAAnnnnrrrmmmmnsssssssPuuuueeeinnnalllll))))nskkkccccrrrtttooooyaaaaaaarrrrI,,,,MMMMrrrddddaaaaeeettttfsssotuuuutttssssinnnaaaCaaaaeeeewwwhaaaaappppaaaddddeeeehhhcccisssssttttttttddddnsnnnnasssffffaaaahhhdddd’’’’ppppoooKooohhhooooaaagaiiiitooopppptrrrrddddoooiiiirrraaaasssnnnneaaannnnbbbeeettttoeeeeettttnnneeee-oeeeuuuurrrrooocrssssiiiinnneeeemmmxnnnnbbbbUsssrrrreeeeoooottttnoatttlllddddeeeammmmhhhhaaaateeeettttdddfffoooonnnnnnnnrrrguPeruuu////nnnnoooiiiittttaaaeeeeuuueeerrrrggggtttteaaaaaaa-nnnnttttiiiiarsssrrrd////iiiiccctttttteeeesssseeewmuuuusssssllllitttaaaaggggddddtttgggguuueeessssnnnnneeee::::aaaaaaallllmddddaaaauuuurrragggiiiittt...ennn.ddddsiiiirrrrbbb((((ooooooonnnyyyyaaaaaaaayppppiiinnnntdddd1111dddoaaaaIsssvvvnnnniiirrrryyyyceeeefoooonnniiiionnnneeer))))sssiaaaddddeeeaaaa,,,,ssssirrrraaaaneuuunnnrffffrnnngggcccciiiinnnntiiiiaaaannnn((((cpppaaaaoooohoooossseeeeccccccttttroa3333tttunnnnppphhhheeeuuuuwwwwffffddddeeeeeeeebbbbnooor))))iiiimrrr,,,,eeennnnvssseeeediiiissssyyyyiiiidmmmsttttnnnnnnncccllllsssddddellllssssddddeooootsaaaaeeeeaaallllccclllttttuuuu----rsssoruooooeeeeffffiiiteeehhhhaaaabbbbnnnsssshhhsiiilsssammmmuuuueeeensssccccdrrrooovvvvccccyesssseeeedddsssooonssssiiiillllttttkkkeehhhheeeennniiiiiiiggggaaaaooooooocdnnnnteeee-ooonaaaaaaaannnnoooohhhkkkknnnnssshrrrrlllweuuunnnnrggggnnnrrrrbbbbt...cccc,,,,ooooiiieeeeaaaaasoiiiipppaaaddddsssssssaeeeessssllllhcccctttttpfffcccccc///oooeeeeuuuueeeeWWW....eeeeywooooooohhhooooassssdllllccc-nnnnnnnddddpppp....aaaauuuuuuuurrrsffffoeeeoooieocccciiisssslrrrrssssrrraaaafctttttttrrrttttuyyyttteeeeflssssttttpppphhhhfhhhhhhhhhhdddrrrrioooot.sssseeeeooooeeeeteeeeffffeeeiiieeewwwwuiiiuuuhrieeerrrrnnnaaaannnnffffgggorooooorrrttttddddxxxemmmiiiigggssssnnntlllliiiinoooouttttmmmmaaaacccemmmmaaaaiiiihhhhrrraaaffffc.aaaoooottttyyyyeeeewwwweeettteoooooookkknnnneeeettttpppn....uuutttssss.hhhhuuuu,,,,muuueee....cccctttrrrtttiiiiPiiitttthhheeee---eeee(rrreeennnnhhhhooomuuu1nnnttttl...eeeppppoooossssnnncccceppp4aaaacccceeeeiooooCCC....acccttt)ddddthhhhrrrrooommmllllppplllstTTTTmmmmddddoooaaaeoooooeeeewwwwhhhhssspppsssaaaiiiieoooorrrriiiittttucccsssdddeeeeiiiiiiiiiissssiiiillllrrrmgtttthhhoooeeeoooos....eeesssshhhhooonnnnersssdddiiiiooonnnnoooooooooooaoooofffooooooooornuuuummmtttnnnnttttttttllloooeooooeeeefffrrrttttt...,,,, should list notes will nyooturbenaamcce,epdtaetSSdeTTs.LUUoEPfDDAraeEEVsbeNNsInNeTTtnGctDDheS(eRRsC)OOn,HoPPstOpe--OOeOtcoFFiLfFFtihcE//PPeArIIesCCRacshKKLooYn--oUUl:fPPoartteanbdseanncceescalenrdk his/her signature. upon your return Copies of to school. SSrttdhheottqeeuuucuddduffeuueemesnnllnlltetttddnesddarrtrriiaaroovvltrppyieeeo--daanoornniffeswffddqm4aaiuddlAnni.lioosddArlsblnneaeppsndlookii,fottccothatkkssoleolttl--looswuuptppwpprmeeoaveiiiiunncvssdeshiriiffdtb,nnerreyoorbwttsnnhhewarttfieesotrcooturffioeffrrtbnnmtoottmehhfnndianeettrikomtddssectccrreu-oaiihhudtmcvvioopueeoweoowwmnanllis..aattpesahTTyyhnitg..ihhiotnonaiinPPnssmtfelliiwweemovecaanneiiausslltllees(sol5taa.ftNN)llofrllooodooetlttwwhalqeeoey::uwffspeTToo.soarrhhtrfiiaasessantffiinoaatss.ssalaatteIeebnaoorrsnnveaaceennna--sddcswwecemmaah.oyyofooorriienneelmaooaaetnnrrrddaddgeeneoorrnyllnnyyceetiddi--emwwrrsoo,aaepppyy.--aooooArffeuufflntt..ltrrwsoormuuittaeetey..nPPcllaeelaal ssaeenuudssee SrrtASSdd12heeoo..tttlqqeuuuccluuddduufaeeuemmeebssnlnnsltteetettdnneenssdaarWCttrciaaaarrfovehlltttrrhpyyiiseeeeeooe-rwcddannorrknii1feieesswwfl-dv:qqmmlo4aiieuudbull5niirlliiossetdrrssbbpPscneeaaeeop.aoddllMosi,,ffrntcsootthhesi.ksoollbooitll-ddlooowwuppeeipwwprrs,eercooevveeiminovvdsddeeuiiarrifddubb,,nrkrneeyyoawwetenghwwaarrdxteiieocttrrccdottufciiooeefrtttsnndnnttooteehffunrdddiinnertrrooammaidddsccnncScruuooaadgcihTLLttmmccvoiiodpuueooUrEEeeoewdmmnnonnDlnAAiw.attnppeetEaaVVTayehhgnnttl.NrhiiIIoottootNNaaainnoTPbnnsptteeGGlliiCpweommooDccoaCcnniaaSSRuuislkllnSlCCessoollOttta(ffmttHHgNblooffPrrluoooeeOOoee-ttillnttwhhdOllqqeOOwooteee:uusFwwlfeLLppeeTioaFen..ssaarhfnEE/etttrrPiasseesAA1.rInnttf1iCooRROattss:..scK3nLLllatheeIIe5lYYnn-aayoorUanovv::acceleenPenaax-dhssdtsswreeccoem1ahhuoom2yoorffo:seoori4ee.nellmms9Taaioa)teett.hnurrrdeaadggDertnneeioreoonnyylnynccwnettiisdii-eeoimmwlrasstlor,,aeesepbppcy..-ewaahooAArreanfeeudfllinnot.llvuttrewwssloedtrrmmuuiisbtttdtaaettyueeeyy.dnnntPcchetlaaneellctallcshsoaaeetnnuocuddnklsteoyeau.vtes 3rAAASd1122e.o...tlllqucllluduaademebbissnsstemeetnennsisPaWWCaCatccsaacrfflseehhlthettrhhayisseeaeeeooeelrrswwccdonnnrrekkil11eeiieeswll--nvv::fqmqlloo44oieeouubbuul55rirrtliseeettiarfsbppPPsssyccpeateoo..aaoodpslMMsst,frrnnhossmotheessiii..eolnbboiiluddddollotwpseemeeiifwtrss,,efrrccieoevebmmcnoovdddeeeuutiaarsduub,rvrrkknneeyaaaeweegeetrggwarddaxxtieeihfroocctrcddidtiuucceioestittdssnddnntooteeefuugirrbdddimnrrroypaamaaiiedcnnrnncca.euoaddggccaLtmccooirddppuaorrEreeeddamnloonlnnAniiwwtnnpettfgaVaareehggnetllorriIotdottmNaaanoobbnppateGlliCCbppaoomocsooCCccnaSpeuiikklnnSSCasolttctr((fmmtHggebbeofruusoneeeeOetiilnntt(thddlqOww/fotteeegausswlleeLmupeiiaaeenn.asaffnniEeetrttlrseeyssedA11..rrntti11oROOratss::.iccn33pnnLlhheI.55sllYnayyoo, aaoovc:ceellennoaxxlddhhsttslrreceooee11ghuuomm22eorrf::sseeov44e..lmiss99TTsaii))ittet..hhtuuraeeaaagtDDrrttineiioeeoooonynnncwwnntisseieooiimtllaasttcllrr,.essee)bbpcc..eewwahhAreeaanneddliinoolvvuuteewsllsseeddttrmuuissbbtddttatyyuueeeyddnnnttchheettanneelccttlccsshhooaeettnuuooccdnnkklltteeooyyaauu..vvtteess M33AAtAA1a...llrltPllltdeHaddynbiiSdsstsoammewnniissPPcWaiccsslcclfellsseahheethaassecOaaooellsorsswoonfrrneefllw1eieeitlnnv:ffciqqli4nooleooeuubl5rrurtteeewiiebaaffpPssyycppehttto.ooppssMesttlnhhoorsommuesiii.eecsnnbiuuekedoolttsseammeeffttt,cffdhriieeehbbmeccnndoeeeet“ttauassusrrvvktrwneeaaeedeggoettrryedaaxfttiiehhffrrtocpiitoddiiuceeh”ssiitddsenncottetilggiiarbbrdammrsyyppadcaseenrrylcaa..eeawdcaassccoirrysdaalrrrrsledaallotllnbnnieontffemggmarrgeeloodT.ddftmmoaooApcaarTCubbpRaatessmoaCDappeeircennnSdaaYhntccyrrmgteeeeeePmurssnnedsOin((tt,ad.//fftnLeggSaaoslammuunItiaugnCaafiideeprrtllYmeyyesldda.rnititenOtraarsnsniicnnppntiwhn..sslfyo,,oigloccrellootxththllhhtllareeoeteggnu2mpeer0bsee1vve.rii6isTssosi-iited2httunaa,0eattt1rtwiiioote7ooinnlnwsltsceehi“httleaccsloir..wre))ob..elcewelyaapnesi”oasvrrets.ohdtoueSmbdtysuetwdntuhedtinetehctncshaoteswucpnhtkaotosoystu.ahtrtoees eMM3aAttcAA2baanove..lrrttPPnedlttddaeerHHsdyydnneytiSSimddqsttmtooaamuawwinneetritsPccCiiccnsedllclleedlcllsdaahheyaeessccOOaeotstlssoobsceooffrnnefkyrfflwwremiictt-nofcciiaqiilonnomlloieeatuullnruutstewwtieesebbatfssdn.hypeehhtttdaeooSpseetbllrihotrraoomuunyueeeiepccssngdupeekkdeeottehsraaameeifttnotsccfeddhhcimephhtbeecnsorsooeeaittu““tcuuaaasnsshrvrttrrtrwweadeaeoddegootrogayyeeaafftirleeetdhfrttoeppdittoodmiaehhrq””siddydeencciutttnmiillugiaaibrraatimrrrrusisypeddncctissterrndlylyioa.aeaaswwgrtatsssstcroiiiryyssopaaallrrrrsslltallooomttail.bbneewoosTfeemmgnammresehk.oddhrTT..deffemooCooAAbccaawrruTThluubtRRaopnrtteesmmaaecoDDaapenrrbknmcceenddaYYdeihhnncyycr(ilatteeesobeneePPmmrrssvwneddcsseOOit(t,,aae..d:ow/fnnLLgSSaoolcaeaacmunnIIttlteluuggeCCaoanirddeepprlrsYYkmmyeellsds1aannwitee1nntttoarnnssi:nniifnm3plttiilwwnn.5stffeah,ooiiggsllacerrrllsnottettihhttMhhlgdhhslaauneeeeettP1lgnn22tm2ppHei00bb:neeaS11v4eerrgki66ii9sooesst--)fieea-dd22.rtunnra,,00odptttD11mwwiyott77toooiiunllptsstllnttaooccehhor““hhrlteeticidssoociia.wwsrri)ooylec.seellccsheellwyyf.eaaoppeeTdssir””aalssulhrrrrtltta..ooeehhrrooyeeedSSsmmcitttmeessuuuittsdwwddvuuueeeieddsiinnnttteehhtttannasssmdaattlsswwtdaooppihhkttctaaooliaooesseotssattniaauhhovttrrapnooeeeeel 3112542621eeeMaaatcccAbbbannnooovvveeessnntstnrthhhdrttttdddPnnneeedddtdtttTTaaaTTeTTTrrraaaHsssydddneeeyyyaaarrrtttaaaaSiiimmmddddqqqrrrrrrtrmmmddtttdoyyyaddduuudaaawiiiyyynyyyeeeeeetttrrrytttcicnnneeedddlledddcccldddayyyeeeeeescONNNtttssstttsobbbeeeooofuuunfffyyyrrrfwrrrmmmmmmiccctooociaaailllnmmmliiieaaabbbtttlnnnusssttteeeweeeeeesssebtttrrrdddnnn...hhhehtdddeeeoSSSebbbliiitttraaaounnnyyyuuuepppcsgggdddpppekettteeehhhrrraaaaetnnnoooceeedhmmmppphtttesssrrrsssoaaaiiit“cccuaaaaaaannnshhhtrtttrrrwddedeeooodeeeooooaaayeaaafrrrllletttdddtoooeeeptommmaaahrrrqqqTTTTTTTT”dddyyyeciiiuuueeeeeeeetnnnmmmilaiiiaaaaaaaaratttiiirrrrccccccccuuusssiiiseeednnncttthhhhhhhhstttrrrdddlyiiioooeeeeeeeeaaaassswrrrrrrrrrrrttttttsstttrrroooiiiiysooowwwwcwwcaaaaaalrrrrsaaltttllloaaaaaammmtaaaiiill...berrrrrroooollsssssTTTnnnnnnemnnnaaamsssiiiiiihhhhhkkk...dnnnnnnhhhT.ooeeefeeeoggggggoooCCCoAmmc,,,,,,aaawwwruuuThhhutttRsssssseepppnnnrrrttttettttttm,,aeeeooouuuuuuDannnrcbbbsnnnmmmddddddcedtYdddoeeeiiihneeeeeeuyccciiilllaauannnnnntedsssooonnnePnmrsssttttttevvvwwwdcccseeeOtmmmmmmniii,aeee.sddd:::oootnLaaaaaaSolllacccmaaaaccckkkkkknItlllstttlllugeeeCeeeeeeaoooaaaarrrdesssssspkrrrsssYkkkmbelsssesssuuuuuuansswwwppppppenettttooonsuiiiniiinfffttttttmmmlllCCCtiiiiiipilllcwmmmmmmntttfeeeeoooaaathhhoigi,eeeeeennnsssleeermrrrlsssssstiiiiiieeetiiithtnnnnnneeeeMMMhggguhsssqqqauuunnnedmmmmmmeitnPPPuuulllne2tttmmmaaaaaaeeepHHHnmiii0nnnnnnbnnnnnnetaaaSSS1eddddddracccgggmkkk6iaaaaaaneeeoeeesttt-ttttttafffdeaaa---d2oooooorrrkuuuanrrr,rrrrrr0ooodddetpppyyyyyyt1mmmowsyyyt7rtttttttttoiuuuuuuuuuuylppptttsptttttttttltaaatooooooooooochurrrt“hrrrrrrrrrllleitiiiiiidddsiiiiimooccciaaaaaaaaawriiioryyyllllllllleeeesssielcsssaelwwwyfff...laooopeTTTsiiirrr”alllslllhhhrrttttaaa.oeeehrrrrrroyyyeeeedddSmccciiitmmmeeeeeesuiiitssswdvvvuuuueiiieeedsssinnnnttttehtaaanaaasmmmdddatlllswdddaaaooopiiihkkktccctttaoiiiaaaoeeesoootttstnnniiiauuuhoootraaapppnnnoeelll 373trrhdd TTaarrddyy TTeeaacchheerr ccaallllss hhoommee,, ssttuuddeenntt mmaakkeess uupp ttiimmee iinn mmaannddaattoorryy ttuuttoorriiaall 484tthh TTaarrddyy Number TTeeaacchheerr ccaallllss hhoommee,, ccoouunnttss aass aabbsseennCcceeo,,nsstteuuqddueeennntt cmmeaakkeess uupp ttiimmee 5951stthht tTTaaardrrddyyy TTAeedaamcchhineeirrstwwraaatrrinnviiennggw,,assrttnuuiddneegnn,ttsmmtuaadkkeeensst muuppakttiiemmseeupiinntmmimaaennddinaattmoorrayynttduuatttooorrriiyaalltutorial 2166tnt0hhdthTTTTaaarrardddryydyy TTSteeuaadccehhneetrr mwwaarrknneiisnnggu,,pssttiuumddee,nnttAmmdmaakkieenssisuutrppattoiimmr eecaiinnllsmmhaaonnmddaaett,ooPrryyosttsuuittboolrreiiaallloss of driving privileges, 377ttrhhd TTaarrddyy TpTeeeraamcchhaeenrrenccaat llallsshhigoonmmmeee,, nssttuutddoeepnnottwmmeaarkkceeesslluu,pporttiimmotheeeiirnncmmonaannseddqaauttooerrnyycettuusttoorriiaall 488tthh TTaarrddyy TTeeaacchheerr ccaallllss hhoommee,, ccoouunnttss aass aabbsseennccee,, ssttuuddeenntt mmaakkeess uupp ttiimmee 959tthh TTaarrddyy AATeddammchiinneiirssttwrraaattriinvvieengww,aasrrtnnuiidnneggn,,tssmttuuaddkeeennstt mmupaakktieemsseuuppinttmiimmaeendiinnatmmoraaynntdduaatttooorrriyyalttuuttoorriiaall 161t00htthhTTTaraadrrddyyy SSTtteuuaddceehnnettr mmwaarkkneeissnguu,ppsttiiummdee,,ntAAmddmmakiiennsiissuttrrpaattooimrr eccaainllllssmhhaoonmmdaeet,,oPPryoosstssuiitbbollreeiallloossss ooff ddrriivviinngg pprriivviilleeggeess,, 7th Tardy ppTeeerrammchaaennreenncatt laalsssshiiggonnmmmeee, nnsttuttdooeppnootwwmeearrkcceeesllllu,,poorrtimootthheeeirrnccmoonnansseedqqauutoeernnycceetusstorial 8th Tardy 9th Tardy 10th Tardy 1. The administratorSATstedauarmdceehinnaevitrsGamtciraElaaaltkNlbisvelEehesRouwfmoAparerLtnc,imoicEnnoegXsu,,unPAsltEttdsauCtmdaioeTsinnnAatibsaTmtnsrIedaaOnktoaceNrsessS,cuissapttlaultsndimcehenoe.tmimnTea,mokPaeeonnssdssuuaipbtroelterimythloetausttsoyoroifuarldrciovnincgerpnrirveicleeigveess, permanent assignment to power cell, or other consequences GGEENNEERRAALL EEXXPPEECCTTAATTIIOONNSS 11.. TThhee aaddmmiinniissttrraattoorrss aarree aavvaaiillaabbllee ffoorr ccoonnssuullttaattiioonn aanndd aassssiissttaannccee.. TToo eennssuurree tthhaatt yyoouurr ccoonncceerrnn rreecceeiivveess GENERAL EXPECTATIONS 1. The administrators are available for consultation and assistance. To ensure that your concern receives 5th Tardy 6th Tardy 7th Tardy 8th Tardy 5 TTeaarcdhyer warning, student makes up tTimeaecihnermwanardnaitnogry, sttuutdoerinatlmakes up time in mandatory tutorial 6thTTeaarcdhyer warning, student makes up tTimeaecihnermwanardnaitnogry, sttuutdoerinatlmakes up time in mandatory tutorial 7thTTeaarcdhyer calls home, student makes uTpetaimcheerincmallasnhdoamtoery, sttuutdoreinatl makes up time in mandatory tutorial 8thTTeaacrhdeyr calls home, counts as absenTceea,cshtuedr ecnatllms hakoemseu,pcotiumnets as absence, student makes up time A student shall not possess, handleA, osrtutrdaennstmsihtaall gnuont, pcohsasiens(ss,),hkanndiflee,, roarzotrra, niscme ipt iackg, usntu, nchgauinn(,se),xpklnoisfiev,er,alzooard, eidcecapnicek,, stun gun, explosive, loaded cane, machete, pistol, rifle, shotgun, air-rifmlea,cahiert-es,ofptisgtuonl,, roifrlea,nsyhootthgeurn,obajier-crtiftlhea,tacira-nsorfetagsuonna, bolryabneycootnhseirdoebrejedcat twhaeat pcoann.reTahsoenseably be considered a weapon. These items may not be possessed on CabaitrermussCmoauyntnyoSt cbheopool sBseosasreddPornopCeartbyarorrusatCaonuynstychSocohlofoulnBctoioanrdrePgraorpdelretsysoorfaittsalnoycastcihoono. l function regardless of its location. IT IS A CRIME TO POSSESS A WEITAIPSOANCORNIMSCEHTOOOPLOGSSREOSUSNADWS.ELAaPwOeNnfOorNceSmCeHnOt wOiLll GbeRcOoUntNacDteSd.. Law enforcement will be contacted. 9th Tardy 9thATdamrdiynistrative warning, student makAeds mupintiismtreatiinvemwanadrnaitnogry, sttuutdoerinatlmakes up time in mandatory tutorial 10th Tardy 10SthtuTdaerdnyt makes up time, AdministratSotrucdaelnlst mhoamkees, Puopstsiimblee, lAosdsmoinf idsrtriavtionrgcparlilvsihleogmese,, Possible permanent assignment to power cell,poerrmotahneernctoanssseiqgnumenecnetsto power cell, or other consequences loss of driving privileges,DRIVER'S LICENSE LEGISLATDIORNIVGEURI'DS ELLICINEENSS/EDRLOEGPOISULTAPTRIOENVEGNUTIDIOENLINES/DROPOUT PREVENTION State law mandates that in order foTrShataestetSupldaierwnittmRtoaoncmdkaatimnestaaytihnbaate idunrsioevrdedre'tsor pfdoeirrsmpaliats/ytluicdmeenensstseatohgeem/ssahtihenatmat iuanrseat midnraikvgeeoroa'sddeptqeaursmtaetiet(/blpiircroethgnrdseeasysheain/nsnhoeumncuesmt menatks,e caodnegqruaattuelaptirongsr,esestci.n) school. Specifically, a student, undeMsrchethsoseoalga. gesSepooerfc1sifi8igc,namsllutyh,satatpsaatrsuesdvethunrlteg,eaurn7, d5oe%frfetonhfseievanegr,eoploloeftde1nc8tl,iaamslslyuessdtpipserarussspettimhvreee,setge7ar5ni%gn-rooerlfdaeetrendrtooollarepadprlecyladsispeslapyedr soenmaenstyersuinrfaocredeorthtoerapthpalny for and keep a driver's permit/licensetfho. erAaronlscdok,kisettseuepdlfea,nadtrsreiwvpehroo'shdpibreoirtpmedoi,tu/altincodefnssstcueh.doeoAnltlswowi,lilsltlluordseeecnetthisveewirahppoeprdrmoropiptr/ilaoictueetncosofensucenhqtouiloetlnhcweeyisl.ltulroAnsec1ct8ehsesirtopethrme irto/lcikceinssoenuantfilrstht ecyomtuernfir1s8t the time and attention it deserves, an appointment is recommended. 2. Please avoid sending messages to students during the school day. This includes cell phone calls and text At Mount Pleasan1wwww33336666tttooo22o24444ooo777888mmmmaaaa9995555SSSSthhh.ddddnnnn..............fff..........ttttiiiiHeeeeeeeuuuummmmttttTCCCCPPPaaaAAAAAAAAsssshhhhttttSSSAAAAddddittthhhhAAAAAAhlllssssCCCCgiiiiiiinnnnsssuuueeeeeeennnnaaaannnnttttaaaammmeeeeecccllllllhnnnnnnnnaaapppSSSSgggglllllliiiitttthhhffffssssssaaaattttssssooooeeehhhhaeeeeeeeaaaaSSSssswssssccccoooeeeSSSSttttdddduuuudeeeerrrsssstttrrrrccccaaahhhhtttoooaaaammmmuuucccce....nnnnaaamvvvaaaaaauuuunnneeeeoooolllrrrrhhhhdddttttvvvccciiictttlllldddnnnneeeeiiiiiiiiboooosssieeefffooooWWWWtttteeeeeeennnnooovvvvnuuuiiiyyyyddddllllennnmmmmooooccccaaaiiiooiiiiaaaeeeei////nnnldddsssswwwwaaaattteeeelsllltttnnnnnnssssiooootttttttssseeeeaaaadddtellllttttrrrreeeBBBBdddffffeeeersssllllnnnnaaaappppDDDDrrrvoooaaaammmnnneeeeaeeebbbbaaattttffffooootttppppFFFettttfffddddtnnnhhhhtttOOOOffffssssssssiiioooouuuaoaaarrrriiieeesssiiiisssdddeeeeoootrrrroooommmmooorrrsssrttttcccceeedddhtttiiieeeennnddddstttvvvvNNNNuuuurrriiiioooouuunnneeemmmmaeeee....nnnn...aaaasssttttnnnndddrrraiiigggPPPPtOOOOmmmmiiisssslllltttaaauuuurooooccccgggeeeooootttt(lllemmmaaaadddrrrrTTTTbbbbsssseeeeffffnnnnnn1lllluuuunnnnttttlllrrrreeeeeeeiiiicccc)tttaeeeaaaccccnnnnccccaaaddddsssrrrrddddsssllllaaaavssswwwyyyyeeeiiiigttttnnnaaaaeeeeppppsssGoooonnnniiiiarrrrooorrrssssooooosssaaapppplllleeeerrrrpppivvvggggAAAnnnssssiiiioEnnnnlgggssssrrrrrrraaavvvveeeaaaaadcccttttooooffffaaaaoooeeessssssspppSssNeeeettttrrrrboooocccllllhhhhccccsssttttcccvvvv,,,iiiirrrrpppTdlrrrreeeeeecccchhhhEhhhiiiieeeeddddeaaatttlllnnnnipppbbbbttttmmmmUeeeeoooooooyyynnnaaaaooosReeeeddddiiiitttfmmmmaaaa1oooocyyyyddddooottttaaaeeeeDoooosssiiiiaaaAllllssssillll.,,,,nnnnlllbbbsssstttllllrnnneeeeppppttttEuuussssaaaaTssssaaaLlllggggdddrrrroooolpppaaaaeeecaaadddttttggggllllSSSiccccNhaaauuuunnnnllllooonoggggaaaatttteeetttteeeeEcccUUUhhhheyyyddddiiiinnnniiTnsssseeeeennnnnnnhhhvvvvssssnnnXeeeessstttteeeesssssssoooostttccccccccauuuuoooiiiiittteeesssnnnnBuuuuuttttsiiihhhhmmmbbbbiiiiPdoooddddffffiiiissseeeettttlnnnndddrrrruuuuPPPooooeeeemElllssssEeeeetesssseeeooooapppccccssssuuulllloooonnnnoospppnnnHffffllllCmmmmieeeetoooorrrrrrllllsllrrrreeeettttniaaaarrrtttmmmmiiiiiissssnnnneoooooooAttttTffffooonnnirrrrccciiiiiiinuuuullllsvvvnmmmmeeeeeeeeaaaapppsssnnnnyyygggeeeeyyyyAVtnnnntmmmmiiirrrreeennnnr....rrridddmmmmallleeeebbbbtttaccccTaIrrrsssseeetttteeehhhppppneeetttttttooooOtsssseeeelccceeeeaaaatttyyyIiiiioeeellllddd....dlllltttaaaaoooooooxxxxooooddddtO...lllleeerRorrrrsssmmmiiiinnnnNNNNppppsyyyyeeeebbbrrraddddnnnncccN....eeeeeeeeseeegoooommmtttahhhggggoooonnnnrrrrccccsoooStttonnnnrooossssnnnniwwwtttteeeeeeeeiiiios----eeeeuuuooottttccccaaaannnsssstaaaaeeeeeedddddlllssseeeeaarrrrccccdddnnnnmmmmeeeeeevndddhhhhttttttttleeennnddddaaaaGhhhhooooeacaaatttssssoooodddhhhaieeeeeyyyddddtttooooffff...Eleeeeooooeeer.hhhrrrr...aaaaallllooooxxxxnnnnniiiiNeeebyyyyeeeeiiiffffiiiiiTTTrrrrTnnnlfffftttt....nnnnnssssEeeeehhheiiiittthhhccccottttddddgccccllllTTTTeeeoooRhhhhhhhhaaaaiiifeeee;ssssrrrssshhhhuuuetttteeeeooooo,,,,nnn....Aeeee(neeeerrrriiiooooeee2oooobbbbddddnnnsssLsllllttt)rrrruuuucaaaaucccoooaaappppaaaaonnnniiiilllreEoooolllltttfffuuunnnnrrrrnnnnenaddddttttooooXdddsssnnnn666hhhhsoooociiiipppptcccnnnnueeeooooh:::eeeeuuuuhPhhheeee555ssslggggrrrruuuunnnnaEtrrrrooos000nnnnaccctccccttttnnnnuuuutoooCyyyyteeecccceeeeuAAAyoooonnnnilllllleeeemmmmod...TuuuunnnnolllllllMMMmmmmneeeeeunnnneeeeeeeepppAssssnssssreeeennnnllllhhhssssaeeeetssssTaaannnnttttooonceeeesssssssstttthnnnttttInnnhhhhossssdnnnnsssOadddaaaaneeeeeeettttttttsrrrriiiiaaaaayyyyhhhhcNaaaa222ccceeeesrrrreaeeeellllaaa:a:aaa:eeeesSraaaa222lllirrrrssssiiiirnlllsllllnnnneeee555ssssiaaaassssssstguuuuffffllllaroooowwwwPPPaaaeeeeoooohbbbbennnn////tcMMMppppjjjjooooiiiiciiiieeeedddsssserrrroooottttetcccceeeeoikkkk....sssspppptttvttttmmmmiiiitttteeeaaaaennnnbeeeexxxttttTrrrrsssssddddggggeoooottttttt....o free from distractioofnas sccahuosoeldfubnydtrhaeiseinr.appropriate behavior of others; and (3) the school must teach responsible behavior. We expect studen7t.s tAo lcl oSntadtuecatntdheFmedseelrvaelslaiwnsaapmpalynnoenr Sthchatooalllporwospetrhtyem. the opportunity to acquire the fullest education tAAAttttrrrrfffiWWWBppppymrrrhhhheeeeooooueeetttpeeeesssseeesssspeeeleppppMMMyyyyssssllsyiiiieeeeeeeifffbbbbaaaaeoooixxxrrrcccconlllldooorrrruuupppttttfeeeegeeeemmmnnneee....ooooobccctttSSSSarssssnnnnutttuuuundddPPPtttteeeelsuuuuldppppiiitssssssslllysssaddddeeettteeee/pppptttiuuuotaaaeeeellllrrrneooooffffrdddaaasssnnnndgssssaaaccceeeaaaahtttteeee:sssnnsntttnnntnnnnaddddiiiddd111155551888118rrrr6666aaaappppllllbbb22229999ttttrrrr11118777733331111bbbb94444111111wwwwaaaahpttttttooohhhhssss....reeeeeeeeddddttttrrreeeeeee2222....5...55....rrrrrrrr........sss3333.........0000....4441111rhhhhhaeeeennnHHHttttggggaaaaggggoooooooeaaarrrraaaa.....................SSSSoooosyooooooooooooaaaaSSSSffffttttSSSSUUUUSSSSsssSSSSSSSSSaaaaSSSStttaaaauuuaddddAAAAllleeeennnniiisCCCiiiiADDDDrrrrsttttoooppppPPPuuuutttttttrrrrrrrrgggttttTTTTtNNNNoooollllttttttttgggttttttttuuuuussssttttuuuuibbbbiyyyynnnnhhhhcccuuuusddddddddeeeeuuuuuuuuuuuuuuuuoooouuuunllllsssshhhaaawwwttttcliiiihhhcccchhhccccddddhhhpdddd,aaaeeeennnncccoooolssssddddeeeedddccccl.lll...llllnnnnddddddddrrrddddddddNNNNddddssssgasssseeeccccttttttteeeeeeeeeeeerrrreeeeiiiuuuooo,,,,eahhhheeerrrreeeetttt....seeeeccccsssswwweeeeeeeeleeeeeeeeaaaeeeeuuuutttaaaauuuunnnnssssuuussssoooorniiinnnannnoooosss,cccctssshhh////nWnWnnWWSSSSssssoooohhhhnnnnnnnnnnnnnnnnnnnniiiitttvvvvnnnrrrrssssssssupppppppeeeeeeddddttttrv....nnnniiieeeettttnnnndtttdddeoooottttssssoooottttttttppppttttttttttttssssnnnoooouuuuesssaaaaaaddddttttsssssssseeeeisssssssssssoooossssaaaassssoooomfffuuuHHHHllllooooiiiioooobbb///eeeesiiiiIIIIgggsssserrrrddddtttssssoooonnnnrrrwwwwevvvvfffpppfpgggffffsddddnnnncccllllwwwwwwwwwwwwiwwwwwwwweeeennnnaaaacccccccceeeaaaaxooobbbwwwwneeeennnntttttttEEEEtoeeeeppppuuutttlllloooiiiimmmmhhhhhhhppppiiiillliiiiffffrrrrreeeemmmcyyynnnnaaaatiiiiiiiiaaaatiiiiooooiiiiiiiillllnaaaaiiittttiiiirrrruuuuaaainnnyyyyNNNNillllllllhhhhsllllllll,,,,llllllllbbbbttttooooeeelttteeessssllllnnnnssssddddttttcooooccccoppppllllllllllllllllllll,,,,llhhhhrrrhhhunnnnllllttthhhheeeeooooeeevvvomtaaaannnnfffyyyydddddddppppsssdddhhhnllllnnnnnnnnnnnnllllaaaaffffsssseeeeseeecccclrrrrnnnnhhhhiiiiaaawwwwttttllllaaaaeeeoooocccttttfoooonnnnoooorrrrooooiiiiiiiyiiihhhhnnnniatttteeennnnmmmhhhhoooooooooooottttiiiibbbbusssaaattttllllaaaaoooossshhhiiiioggggMMMMyyyycccclllliiiiooooiiiiiiioooosllllliiiiooooccccaaaaaaaaaaaatttttttttttttttttteeeennnccceeeellllsoooopvvvvssssllll,ttttnaaaaoooorrrroooeeeeiiihhhtsssttttnnnnlllloooowwwwllllllllllltttttyyyyeeeerrreeeeaaaahhhhfffttttnnnuuuuoooonnnnsssiiiiruPPPPuuuuttttannnneeeeeeeiiilllloooeeeennnnaaahhhhooo....eeewwwwooooiiiibbbbfaaaaosppppaaaaaaausuussusnlll,,,,....dddddlll::::HHHHooooppppttttooootttaaaarooooooootttrrrroooaaarrrrrrrrivvvddddeeeeuuuuhwwwvvvvpppiiiiaaaannnniiioooodoiiiieeeegrrrrennnnooooeeeerrrrrrrtnttnntnmmmmdddBaaaa(((ooooooeeeiiiiSSSSnnnnssssirrrriiiiwwwwpppddddaaaarrrrmeeeoooonnssss11ssss1ooosssseeee....boooollllnnnnttttsssnnneeeennnrggggrrrUttttppppeeeessssppppoooorrrsssiiiirrrrppppFFFFrrriiii)))ooooetirrrrcccceeeeyyyyoooccccpppaeeesssseeeellllsssstkkkoooosuuuueeeelllliiiooooooolPPPPpnnnnaaaaooooddddnnnnLiiiillllCCCCeiiiipppggguuuuaaaattttnsss,,,,nnnsssseeeaccccrrrrddddggggddddfffpppphhhhssssssssmmmmerrrroiiiidaaaa,,,,tttnnnnwwwyyyyrrrssssrrroootppppLbbbbttttaaaaaaaasssssssttttaaaiiiihhhhaaaaeAmmmmaaaaitttiiinmmm,,,,.rrrrccccuuuooouoaaaoooorrrrooottttnnnnppppeeeeeeeeppppbbbbopppphhhaaattttiiiuuuoooorttttYttttaaaatttteeeeoooottttoooottttnnnnllldddddddsssseeeeclllltttnyyyyaaaaiiiiiiiuuuuiuuuuiiooooeeerrrTsiiiiffffSSSlllllllaaaaiiiiccccgmmmaaaaeeeeeeessssssssnnnnwwwwtttceeeeccccIbbbbkkkkaaarrrrcsssssssssssssssstttttttsssttttuuuuTTT,,,,hrrraaaarrrrrdddssssyyyyaaarrrriiiiNnnnneiiiinnnggggeeeeiiiieeeiiiieeee,,,,heeeelaaaccccaaannnneeeccccobbbccccddddppppuuuuffffttttnnnsssnsdddooooeiii.pttttdddUUUttt::::,,,,ddddpppphhhhnnnhhhhoooofffssfsGorrrreeeessshhhhhhhhueeeeeee,,,,ttttiiiisssssssssssaaaannnnmmmggggBteeeedddduuuoooocccrssssrrrrrrrrnnneeeehhhooooo,,,,aaaaapooooLLLLDDDssssnnnnoooottttttteccccsssseeeeoooorrrrcciiillllllluiiiiCCCCiiiiggggnnnnliiioooobeeeaaaoooeeeeooooAsooooaaaaaaaapppuuuutttcccceeeeaaarrrrrrrrnnnnpttttnnnnttttnnnaaaffffEEElrrr.ppppvvvlllliiiilllliiiiddddlllldllllttttssssaaaahhhhrrrrlllwwwwooooppppiiinnnleccccaaaavvvvlllleooooNiiiiiiilllljjjbbbbiiinnniiiaaaaaaaahhhhyNNNllllttttnnnnsssnnnnttttauuuuoooooooaaaaattttooootttnnnnnnssssBoooeeeennneeeeiiiirrrrrrrrssssttttrrrriiiieeeehhhtttiUDaaaannnnnnnneeeettttooootyssssooooiiinnnnaaaauuuueeeennnneeeerrrvvvvTTT,,,,aaaaaaaooorrreeeccccneeeeeiiiiunnnaaalllliiii////iiiiaaarrrrnnnnllllyyyynnnnsddddttttmmmmrrrrnnnnttttnnnnshhhheeeettt/llllgggggdvvvvssssltttgggyyyyffffoooiiibbbbOtttaaaahhhhssssooooessssBBBffffpppplttttssssoooobbbsssinnnniiiiooouuuussssssstttt,,,,oooorrrbbbbiiiioooofffyyyyyggggssssppppppppmrrrrseeeepppggggaaaprrrrooootttooooddddeeeccccaaarrrPRlllleeeeEEESSSS////nnnncccceeeeirrrreeerrrruuueeeeooooooorrrrllloooohhhhagggg...ggggooohhhhllllaaaapndddaaaaddddcccclllaoooooaaaassscccc,ttt,,,tcccttttppppdddrrrreeeeHHHtrrrraaaaoootttttttccccuuuutttthhhoooohrrrreeeeeeerppppgHysssthhhhffffttttlhhhhuuuuooottttssss,,,,hhhsssseeeeeeeeeeellllrrrraaaawwwaaaaaaaeooooieeeeaaaammmmeeeaaaaoooooeeeeeeeeooooAAAcccciiiinnn////oooonnnnnnnc,,,,rrrroooeeeddddcinnnnmmmmrttttAttttrrrrrrrrbbbbnnntttggggwwwwrrrrvllllhhhhccccttttnsssiiiieeeeynoooosssrrrddddfffggggiiiieeetttaddddeeeeVVVssssoooossssyyyyiiiiooooaaaatttiaaaaoooosss”””sssoooouuuffffRrrrrcppppiiiillllnttttiiiiiiiinnnneeeemmmmooooooooiiiiiiidiii....nnnnnnnnuuuulttt;;;ottttiiiittttnnnnnnnneeeellll000aaaaaaaIIIoooolmmmnnnnuuuurrrrehhhhhhhnnnnaaaaoooottttiiiifffllllAeunnnnddddggggBBBBOOOfnnnnolllssssiiii....”””llllooooaaaoootssssaaaagggg,,,,ddddeeennnneeeedttttdwwwwttttbbbbeeetcccc----cssssnnnntttnntn....iSrrroooottteeeetttmmmiiiirrrr((((eeeeeRRRaaarrrreeeehhhhnedddoootttt,,,,ceeeeggggWWWWooooiiiimmmmiiiiddd,,,,aaaabSeeeeataattataaaariiiinnnllllaaaa,nnnnllleeeelllltuccccaaaaoooo....rrrrrrrrlllloooonnnnnnnnuuuiiillllieMgggdddsssstbccccooooaaaappppddddttt....rddddttttnnnm(((nnnnHHHHssssnnnnonnnuuuuyyyyhhht,,,,eeeeooo333bbbblllliiiitttturrrrlllleeeeiiiipppwi,,,,uuuunnnneeeecccoooowwwwnnnnssssEtttooooeeeoooieeeen)))AAAAurrrrtttttpppptttthhhaaadddddppppffffrrrrddddhhhffffiiiiyyyyiiiibbbbggggedddsNiiiirrrriiiiieeeerrrmmmmlllleeeeoooommmmeeetttaTTTToooiiiipiiii...eeeeeeeelllleggggsjjjjllluuuueoooohhheeellllmmmmnnnnnnnnggggffffllllteeeeeeeeppplllennnnTaaaaeeeenhhhhcccnnnppppeeeeeeeeieeeeeeneeeffffaaaaggggcccctnnnnttttttttrpppnnnno....NNNaaappppdddd,,,,nnnnppppoooohttttttteeeeaaahhhhrrrrohhhhttttst((((ssssoooonoooggggfffsssnnnnllllaaaarrrrccccrrrrddddeeeeeeeeerrronnnhiiiieeeetoooeeeeeeeoooocccttttrrrttttmmmmuuuunnnnnnnnnnnrrrreeeeooooddddllllttttnooomyyyyeooooyyyytttlttthhhiyyyyeeeesssssssshhhhbbbbaaaacccciiiddddieeeuuuooon,tttnnnneeeeoooonnncccckekekekessssmoooaaaagggglllffflfeeeeiiihrrraooooaaaannnttttoooooddddssssuuuuhhhhfffnnnneeeerrrrwwwwgggiiiiiiooohhhtttteeeeeyfffforrrriiiiiiissssaaarrrrttttrccccssssdddooodooooo;;;lllrtttcccooooteeeooooiiiieeeessssuoooooooo,,,,aaaayyyoooobenmmmmrrrriiiiooootttttaaarrraaaaiiiiiiffff(((llllaaaammmrrrrnnnnffffhrhhhhmmmmeeeennnrrrrdnnneeeeesssse222lllltttnnnnttttllllsaaaatttgggg....iiirgggssssuuuuiiiirrrrtaaaaggggssss)))uuuoooooooayaayyyaooossssiiitnnnnrppppohhhhssssaaaauuuaaaayyyynnnnpppptttooa))))eccccllllppppccccsssSSSSnnnoooouuuuueeesssttttaaaa....nnnneeellllmmmmtfddddggggtttappppaaahhhhaaaaeeeeddddeeee...nnnnaaattttgssssvllllsssnnnnoooyyyylrrrrscccddddttttlllluuuurrrr6oooooooorrrccctttaaaabbbbhttteiiiiwwwwoooocrrrssssqqqRRReeeeeeeuuuussso....oooohhh:ddddssssoooooooobbbbroooiiioooohuuuussssccccaaa5uuueeeeggggrsppppiiiibgggrrrrnnnneeelllleeeellllllccccwwwnnnnlllleeeeppppocccosss0yyyyddddiiissssssssaiiipppooootnnnnllll....hhhhaaaarrrsssshhhnnnaaaatttossssaaaah....ciiileeessssuuueeessssttttooooAiiiinnnn,,,,llllllltttttttaaaliroooossssaaaCCCCnnnnccccssssaaaatlllddd.aoooorrrooooelllaaaaddddvvvveeeearrrrMtttaaaatttrrrreeevvvvaaaaleeerrrrassssbbbllllnnnneeehhhssssueeeepppyyyynnnnbbbbsssiiiinnnneeee----nnnhhhhntssssdddmmmmeeehhhhyyyynmmmmeeeaaaaaaapppssssesssseeeeyyyyttteooooammmmlllliiiipppptcccnttttooooooffffpppbbbbaaaacccciiiicccstfffiiiiuuuuhhhnkkkooooddddoooonnnneeeennnwessssfffgggguuu,ooooeeeellllaaaaeeeyyyyaaallllrrrraaadllllfffnnnneeeeccccdooooaaaasssaaaattttnlllhhhhrrrddddlllloeeesssgggsssseeeelllhhhhiiilllliiiissssmmm.oooobbbbttttaoooonnncccceee2bbbrnnnn))))rrrriiieeeeoooooooouuuubbbbTaaawwwwcccceeeemknnnoooo....ssslllliiiilllsss:iiiggggrrrroooossssaaaahhhheeeeeeetttttt2iheeennnneeeegggeeeerrr....ttteeeessssnellllaaaallllaaaasssssssvvvv5iii...eeessssddddeeeWWWWssssuuuubbbtttt-ttttggggrrrriiiireeeeddd....ddduuuuffffcwwwggggbbbbeeeddddPehhhAAAAttttrrrruuuu...aaaauuusaddddssssHHHHhhhooooeeeeeeeejjjjyyyyiiitttMnnnniccccacccclccclllleeeeeeeelllssssbbbbrrrraaatlwwwwttttrlllhhhhEEEEtttccccFFFaaaennnneeeeccccffffivvvaaaaiiiioooemmmm.nttttiiiisooootttbbbddddvvvvttttooottttaaaaiiiccccRRRRiiiiggggiii,gooooooo3eeeiiiiooooooobbboooccccyyyyaaaatttthhhhttttEEEE,rrrllllnnnnnnndddooooooooeeeaaaayyyyyyyyssss,,,,tttt... ttwiitBBSyymmeetuuexppauppbllcteedllillhsssyyniieieeeiingtoonnrdde,tff,gg,sboobbaTaarrlwuudohnnmllsshglleddttyyoaagi//MniioottinneenfirrseddggPghhte::H,rttaald1ba1hhpparrStre54rrbnhhaaooeea..ussdyysruaalssClsscPtttgltiioiihsshinnhawcchre,,oreggaaedtiaaeoollati,nninaa,,hltntnhrriddteehwtneesaememfa/geetrrergssrxxonootbattuoshrrmccttesstaiiniiellasticcooruu.tefttfdsdennssflldac,iyyiiiaasamshooilltoncppn,,noerrfsrraaooemsffoonnlirrttoanhhwiuddoobrdBBotiidmmeeoibbnrrmUUrrereeiipettknollppLLaeeiseaatfdeeddttwrtLLaaeesiitm..soohieurtrYYclennrierTTlgghtdvIIaaathhrrraoNNinelleoocdaee..odtsGGuuetsmlBBurrs.ppteescluu,ioAAssBtcppnall..ahinlleeuNNijnnyysoaaonBBldtiiDDlttioraonnyeeuunaltt//ggddillghOOtnllbbosryyemmppgtearyRRiiuaa.mnndaacadttaeggHHyyttoneaneenndoicciirrAAnnnnnsftaaas”HuRRccnndooo0llmuaffAAuuffoo”ofrlddeicctiiSSaracnneedccsSSone,,lttuusui.iirMMdmbbrrnmmnuuapAiiecEEtiinnntthaddnhnoNNiireaappt.ssyettteeTThRcniinnrroosNaeteoosstnnrfoonputtoennoosmmtdlliieto,,rtemmuiraattoofniihdyyiniiarrtcettegbbeettarniwhhnddeettFirrghoittrroosoutooeeonhuusreaam.oggvvsbolluhhteereRssoorrlildrrssbbgeiawooeaaiprttnrhhccveilleelaiierrattlaapaeelastlloaavbeuuphnnttrdaennaeeteiettcnnlopsstttakowweehf,,ebafrddnnerooelgm..eaasnrricTThmmkknsiootiihheegntnnnees.eeehc--ggrrdtccweeah.ssaarsieiiaanlllttllrrlbFeeiiCeenntssboeoC,,gg33eeo,,Snda tpppSPwwihhhtttBSSSttymeeeeeoooTaaatttRueexxxpaauuulllrrrpbblccUttteiiiOdddlaaaiiilccchhsssynnnieeeDsssiiyyyHeeeinnngggttosssnrrdeeEeee,,,tttsssfI,,g,,ssshhhdddBbbbNobaaTTaaaarlllwwwuddITooooohhnlllTmmlshhhlllgggrrrleedtyIoooagggbbbiiU/ObbbMMnniotiiieeenennnfffSiiuuurNsseeedgPPsssgggElllhtteeeuuulll:HH,,,rrtiiialllaabbbhpAeeeaaarSSOttrbbbnnnhjjjdddaooGeeeeuuusdddyssFrracccsssslllsccAttttlllttthhhiooihhshhhiiincSIrrttteeeooo,ooeeegaNooodddOuuuaooooliii,,,na,lllSdddllttnnnCdddhhrdehhhTiiiwwttteeesssIeeemaaarrrecccrrAeerrrsrrreeeDxnnnoiiibbaaatsspppLppprcteeesssssttIiillllaaooossstttiicSoiiiu...tteeeffrrrnnntNeenCsffldddtttaaa,,yiaEmmRorrriiltttooopnn,nhhhTyyyIeerrrraeeeMmmWssfoaaaniiirttnnnhccciiiuudobbIBnnnOtttittddmNeeiiibiircccmmmUrroooeeeRiiiiAtnnnnnldddpLaaeiiiaKttTdddeeeedtttLuuuaaaessnnniI.IssopppeetttrYNOtttcceeenrrTghhdddtttvvIGtttaNooohroooooNiiloccaaae.,ooaaaGueeaaatttSllBrHnnnss..peIsssu,,tttdddAsBBTcccpAeeel.aahhhleaaauuNiiiEnnRynnnaoooBcccllddiDSlltoooAhhhcccnyyeu,llllltteee/gdiiSluuuhhOnnlrrrbbbBdddSyeempggyyyRiiiiMLoooammnnnnaaarrrtaaaOgHytgggnnEaannneaaaddGiicirAeeeNnnndddnaaaaxxxHHGRcmmmTndddoopppoluuuaaffAuIuuufoiiiffrrlllNAnnndiilllctttiSaaccsssniiiecGNssSsssiiioooee,tussooottt..irrrMD,mmbrrrrmnnnaaauaaaAA...iAeeEinnnnttttBdnnooonnNoooNiapttUrrrsyyttttDeThhhRRinLiiirosseeemmmeeosttLnrrrToppuutmmmYnoosssmddlHittt,rrIeeeeemuuuattEoNdddnniidddynniriiitteeetGggaaabeItnnnwwhdNtttetttFFeeerPhhTtrolllsssoooyyyeooohhhurrEa...lmmooogvbbilRcuuuheeessSSSoyrlllNlldddrstttbiiaauuuoeeCEarrtrrrhcvvdddeeloTeeeieereeetapppdaaeassnnnloooavveuPttthhntrrr:aansssetttoeeiietnlllwwwsttttaaooi1wehhh,cbbrrhhhd7neeeyoll.1oooeeassrcccT0hhmkCooooovvv/ihee4onnnnniiineeooo0dhhccc-grlllttceee2eeaaaaahhsarrr:1ssttteeiannnleee/tlrbb7e4iCCentttsttt23eeoooCChhh,g33ee1iii,SSnn0aaa2sss DteIaSchCeRr,IaMdmINinAisTtrIaOtoNr,oHr AotRheArSsStaMffEmNeTmAbeNr DatBscUhLooLlY. BINuGllyCinOg ManPdLHAaIrNasTsmPeRnOt RCeEpDorUtinRgEFPoormlicsyaCreodaev:ai1l7ab2l0e/4o0n1t5h/7e2C2C5S website, The MPHS school website, in student services, and the main office. Any student who believes he or she has been PPhaRRrOOasHHseIIdBBIIoTTrIIOObuNNlliAAedGGsAAhIIoNNulSSdTTreDDpIIoSSrCCt RRthIIeMMiIInNNciAAdTTenIIOOt tNNo,,aHHtAAeaRRcAAheSSrSSMMorEEaNNdmTT iAAniNNstDDratBBoUUr LLimLLmYYIIeNNdiGGatePPlyoo.lliiccSyytuCCdooeddneet::s w11h7711o00v//44io00l22a11te//77t22h33i00s pSSDDCoTTeIIlSSlUUilcCCDDpyRRhEEsoIIhNNnMMaeTTlsIIlNNabUUnAAeSSdTTsEEuoIItbOOhOOjeNNeFFrc,,etHHlSSteoOOAActdCRCRroisAIIAncAAiSSicpLLCSSldMMEienNNLvaEEEEiLrcNNTTyePTTsWWaHhcAAOOatOiNNvoRRNenDDKKEfuoBBIISrpNNUUeAvtGGLLoeNrLLaDSScYYnIIhdOTTIIaNNniEETnGGgSSHce,,ldCCEuBBdoROOuiLLnMMrEOOgwLPPGGeoELLxGGrCpAAldIIuTIINN.lNNRsGGWiTTOo,,nhPPNi.AARRlIeNNCOOiDDtCCDisEEETTnDDVHHoUUItEECaRRgEIIEEaNNSinPPTTsooEEtllsiiRRccyyhNNoCCEEoooTTl ddreeuPP::leoo11sll77iitcc22oyy00c//CC44ar00oor11ydd55eea//::77c2244e2233ll551122 phone on campus, this must be done within a specific set of guidelines: Electronic devices may be used by students at PspReOcifHieIdBtIiTmIeOs NandAlGocAaItNioSnTs foDrIiSnCstRruIcMtioInNaAl pTuIrOpoNs,esHoAnRlyAwSiSthMspEeNciTficApNerDmBissUioLnLoYfItNheGtePacohliecryanCdo/doer:adm17i1n0is/t4r0at2o1r/.7230 STUDENT USE OF SOCIALCCEENLLELLTPPWHHOOORNNKEEISSNAAGNNDDSIOOTETTSHH,EEBRRLEEOLLGEEGCCITTNRRGOO, NNAIINCCDDDEETVVHIIECCEEINSS TERNET Policy Code: 4312 ensure that years old. School requirements. your concern receives administrators ysweiralvlresndoobtliadfs.yistaShncedhoDnooelpgaaurdatmmraiennntietsetrosafatorMersmotwaodirlelVtnheoahtiicmfyleessthsaoegf eDssteuwpdaielrlntmntsoetnwbtheoopfahiMnatvoeedtonor ovVteremahteictalnetyshetoismef es.tudents who have not met these TTIMMptrshneeehheqreePrceevsussHroeossioSSnraadSnceppjggakumbdiieelrrnarssieiiastecttnpsioostseitRRpsrrosleaf.oocnss,anocciiraggwdkkdarnneninetssmmcShoipesttPaahhrgtyyhiooIaaumRhefttabbipsrICaabeetalTrruieaneetuudmbetRsseevvadeeeenOruu,nddrstllautsCggaensttaagrdooKdrreCr,,tesddmooaootiiuutssffaplndffppydreeetlloennyaanmssyyfttShiifsovvecammwteechte,,teeoimltsstppohlhsseooleaaresttBeggieeshrcaeennoeMeassgattaiiicevrlaaPttadtsehhllhSdH,llwaayyaPetattShpminIddlpeaaRldDiiirrrsscnMeeIosRrroTappuuPiitEferppnneHRibrttSatfiieSyOggvvtoSeeeooproaCCm,,ooacfdoddiKggOamnanaanltDttsnnilecaaneggdseEssqittt--suaoueerrtneerdveall((deenaabbtnrcitttiioeetehrrasddnttstehh.aiaaddoorsnnaarriAwydnyyaatcetrrseaailceetmrlnnaeaddafnnsecfssiioo.tssibuuttppoooennllnlaacceityyewheeneevmmesiddeturheerotoonnehocnnttaktassht,,aapie“nnsccrotyyoohossnnientsstuggiuudvadrrrrraaeeffefttaa,nisuurccptsllsseeaarta.ott”oonciifoottoedhhTnnsmeesssh,,rrieeoeettfnhhttiaccraasl..nn))t TmmIIIEEEMbpppdddIttaaasMMAAsseeeehhnnnfaeeddddttteeeeiiihxxxaassseerrmePPParrruuuuaaasscccettttrrrvvyyssssttrrrnnnHHHccccorruuuoooseuueeoooseeeooaaaayyymmSonnntpppaddSSSnnnddmmmuccittttptttjjjgniiiissseeaaaseekkiiiuuudbboooodddeeeiecccooonnhlllseernnneaannnnsssrrrshhhtiinnnttttoiaaanrsstteeecccaaaatoooiii,,,rpppssummttiitossstttnnnllllhhtsseeoooiiiaaaRpppcsssrioooeeeelluueelllasthhheeeaaffodddcccnnnnnnnisnsseee,,aaannaaaoddaooocaaittvvvvdvvvrrriiiaagwwwndd••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••rrsknnndddrrraaaiiiibbeeeeerrknrrasssogggeeennniiieenneennnoooossttteltttsmuPPPPTTTTiiiiUUUPPPPUBBBBTTTTAAAAuuuuSSSSTTTiiiTivvvvTTTTPPPPHHHHTTTTJJJJeeecccyyysshhhoonnnntttiiidLLLLnnnnssssiippdeeeerrrtiiiieeennnnssslllaaaaaaaahhhhaaaatnnooooooooooooooooooooaaaaannnnmmmmrrrreeeerrrccoooohewwwwrreeeeaggtttnnnntonnnnnnnnjjjjttddddwwwwttttooooeeeppppppppnnnnppppppppppppyhhhiiiaaaaoooooooddddllllsssaaaaoggggooyiiiiccauummmoooofeeeettttttttgggeeeeeeeeeeeerrrrssssssssssssssssddddssssddddcccc,,,ddhheeefffeemmmmiiii,ootssssssssggggaattttttttnnnnrrrrnnnnllllbahhhaaaddddcllllaawwwwrrrreebbb,,,,ssssiipppmmmmaaaasssmmmmmmmmmmmmmmrrrrhiigggiigrreeeeCCCammmmttttlpppprrrbbcccceoggggaaaannnntttteeennnn,,,,’’tttaayyyyooossssnnnn....llltaaaassssdddhhhhreeeeeuuueeeessiieeeemaaaaaaaeeeaeaaaahhhhnnnnuuuuppuuuuaaaassssnnggggdddeuuuuddddrrrrppppttaaaalll....u,oo,oo,,rrrrrrrrdddoooommmrlllkkkkPPPPbbbyyyyyyyyoeemmmmssssllssssooooaaaalleeessssttyyyaaaasssstttmmmmrrrrpmmmmiirrrreeseeppppffffeeettttttttvddddaaaiiiiddhhhrllllsssssrrrrttttaannnnnnnnaaaarrrreeennnneleeeennee((((eeeennnttttrrrrppprrrsssurrrrhhhhccccaaaa,,cccciiiiittttnnieeeesbbbbnnnaaaannnnttttiiiissssdaaaaooooaaarrroooooooossnnnntttteeeeggsssssatttooooiiillllcccc....lsssshaaaannnnaa,,,,ttttooouuurrrrcceeeetttnnnsssddddeeeesssseoooogttttssss,,,,ffffttttttttn,,,,tteeeeccccmmmmaavvvveeenneeeeoetttteefffaaaaaaaasssseeeehhssstssss....rrrttttdddaaaaahhhhmmmmddeeeessssffffgggttttcrrdddoeeeeyyyyrdd....hhhhcccnnnneeeennnnoooohhhhiiiintttnnnrppppnnnnweewwssssCCCaaaaeuuuurrrrrtttthhhooooiiimmmmsssssss,iiiiiiiiddddheeeeiiiippppaaaasssstttaaaaeeeoooollllttttddddeevvvvnnnssnnnndssttttnnnnaaammiggggoooiioooeeeweeeesssseeeeooooettttaaammmmyyyyssssottttttqqeeeeleeeeaaaattgggssssnnnnifffggggsssssssshhhhuuuuuaaaattttddddlddddhh,,,,rrrrrttt,,,,sfeeellluuaaiyyyykkkkpppppppeeeeiiii,,,,,llleeeeiiiittttaaaannnaaaaddooofrrrrtpfddddaaaatttaaaavvvvdyyyddpppplllliieeeehhhhoooorrriiiieeeeaaaahemmmddcccccccceeeearrrryyyyyyynnnncccrreetttyyyyrrrrnnnnlnnnneeeeooouuuurssssrrrreerrrrttttaaaaeeeemmmnmkkkkaaaayyyssssrreeacttttnnaa,,,aaaooooemmmmdddddaaammmddddssssnnnnnnnnlllleessssccccppppttttllllmmseoooosssttttsyffftttttffffttggggsooottttSSShhhhkkkriiiihhhheeeessiiihhioooottttooooeeeefffssoooossssmmmmffffhhhhiiiisssssnnnnaaaaoooerrroooaaaavssssasseeessssbbbbeeeeeeeccceettttaaaa,,,,eeeettttaavvvvllllmllllccccoooostttteeeewwtttttttrrrrnnneiiiicccdnnhhh---eeelllleaaattttaaaa----mmmmhhhhttttttcceeeeeeetttteeeembbbbswwwwcccc////pppplllloooouuu,tttttttoooo...hhhhuehhhhttyyyyooottttiiooeeeeccccddddrrrrmmeeeeeeeeeeeehhhhvvvvdddpppphhhhwwwwppplltttcuuuubbbbsaaaatttaaaapoeoooaaaassssaaaawwddsssshhhlliiiirrrrhhhaaaaiiinnnneeeeso,,,aaaattttbbbboooossssiiiisssstttteettttrnnnnosssslllssssiiiisssooooeeooooeeerrrrttttsssstarreeeehheeettttttttoooottttnnnndeuuuuaaaiiiissggggooootttaaaahhhhsssstossssBBBrrrruuuueettttgbbbbrrriiibbbbessttttaaiinnnnnnnettttddddgggghhhiiiirrrrrrrrggggbbbbaaaassssaaaarrrccaaasllggggaaaauuuullllllllaaaaaaenaeeeeoooiiiieeeetthhhhdddooootteeooooppppeeeeeeeMMMaaaatttteddddeeeeeecccpeeeennnnhhhhaaarrrrggggsggddddaaaanaaataaaaaaaaatttteeeennnnlllvliihhhhtttuuuuiiiieeeesssseeeeiocccssttttmmmddddwwwwuuuueeeeeeaaaaeeeevvrrrnnnniiilllllssssvvvvattttebbbbPPPeeeessssxxxxtiiiiittssssaaaooolllddttdtnnnnsssssshhhhiiiittttmmmmnnnneenhggggggggaaleeee,,,,rmmmmihhhoooonnnneeeeeeeeoooddddnnnnppppdddHHHnnnssss,,,lttttttcaaaaaaaaennoooohhhhwwfassssddddrrrriiyoooodddaa....’’’’eeeeooooaaaaooooeeehhhheeeetttttttryaaattttnnnneeeemmnnnnttttttttddtsssseeeetttSSShhhppttthhhthlllldeeemmmyyyyassssttttiixxxxoooooooonnn.nnnnoooaaaaeeeeyyyydiiiiAAAArrrriillppppeeeesssppeeeiiiimmmmcirrrrannnneevvvvccccccccnneeeellllllssssdddxxxxttttDDDnnnnnnnnisiiieeeeeeeetttteeeetttrssssttttrrllllkkkkeeeexxxxiiiiseeeecccoooggaaaannMMMhhhhcpppphhhiiiiioaoaaooaiiiierrrrllllvvvvoossssssss,,,,sssRRRpppprossssaaaaiiiiddddmmmppppmnnnnfffiddmmmmooooooaaaaeeeiiiitttteeeeaaapppppnnnnuttttiiiiiipnnnnttttnwwwwaaaabbbbPPPoooo----yyyyoooouunnnnillllwwwwnnttEEEssssdddaaaafffeeerrddddpggggeeeesssslniiiilllleeebbbbdddd,llllffffsssseeeeeeeppppHHHrriillllrrrbbieeeetttteeeerrr....eeeeyyyyteeeeoooohhhhssssSSSdddttttppeeeeooooaaniitttttttceeeccccfffissssaaaagggghhhheemmmmeeeeooocccconnppppooooeeeeSSSyyyrrrrgeeeeuuuvttoooSSSllvvvvoasssddddaaaappppaaaaaaaaccccttttrrrraaeeddddttttaaaaiiiinnnnggnnnneossscccpprrrrrrrreeeeiiiimpppphhhhuuuuiiiicccceeeeooollllttttooooaaaccnnnn....CCCoooommmyeeeeeeee,saaasssossssiiiaaccitttteeeesssseeeessssttdddfffnnnnsssseedddaaaattttooooppppddddaaaa’’’’nnnntttttttphhoodii,,,,ttttghhhhOOOrrrreeeecrrrr;;aaaeeeuuuuiiissssccccmmmnnaaaiiiinnnnsssslllllnneeoooh((((hhheeeellllnnnnannnnoeeeeddddnnneeeaaaaaaaattttddddihhccccoooolllttiiiieeeettttDDDtffffiiiinnnessniiillloooommmneennnnrrrrooooccccooooyyyy....llllcccoooossnnnnaeeeeooooooeeeecccckkkknnneeeeeesooooeeeeaaaghhhhddooooccssstttteeeffffeeeesEEEnnnnddddrrrrsrrrrwwttttssssnnnnnnnn....,qqiiieeessssttttlllttthhessssiiiiddddddddteeee-eeeesssbbbbtttttttthhhhuuussssssssaaadddnnnnooeeeeauusssseoooorbbbboooo’’’’eeqhhhhpppsssstttnnnnooiiii....eeee,,,,eeeeiiiippppnnnesssseeeenrrrdddvvggggeeeeeeffffaaaa....vvurrrnnnnooeeeeccccbbbssssaaaaaaaooool(iiiissssdddeeeeenndooocccctttteecccchhhheatttteeeellkkkkggggbtttccccyyyoooobbbbrrrr,,,,rrrrnnnrrhhhhkkkkmmmmcccccrrhhhhiiintsssseeeeeeee,,,,tttiiiiillllddlooooooooooohhhh,,etttsssseeeaaaaeehhhrtttooooabbbbaaaaaaeeeecddddsssaaaauuuuaauuuutttthhhvvvveeeednnntssseeeesswwttttttttttteeessssllllrrrreoooohttttyynnnnxxxxehhhhsssssss..cccceeeettttaaaaeeeaaajjjjtttteeeeiiieeee.aahhhhhhaaadtttteeee..orrrraaaaaaaadddduuuuddddiiiisssggggvvvvxxxxwwwnnoooottttaaannnnnnn....wwwweearllllhhhhggggeeeeaaaahhhhriiiaaaaeeeeppppAArrrrwwwllllFFdddyywwwwdddnnnnnggggyeiiirrrreeeeaaaallllnnnnaaaaeeeeeeeeaoooolllmmmttttoowwwwccccvtttcc....eeevvvvttlllrrrrlllliiiillllggggiiiirhhttttssssssseeealllliirrkkkkmmmmiiiimmmmrrrrelllccaaaaooooeeeeettteeeeiiinnneeeesssseeeemmnnnnrrreelllyyyynaaannnnreennnppppeeaaa,,,,aaaaaaaaoooeeeeggggaaaatttttwwww,,,,daaafffnsssssseeeeiiixxoosssseecccrrrrwwwwsddddvvvvfffsssstttggggssskkkksssssi,,,,cccceeee,,,,o..rrtttaaeeeeaaaa....rrrraaaasttteeeebiiibbbbbooooiiiihhhhssssurrrtttaaaaoooonnnnuuuummttpoooggggssmmmmnnnnssssaoooooeeeeeeaaakkkkaaaanrrrrrrrrhhggggddddlssssnnneeee....cllltttppiiiiuuuuaoooouuuuttttpppcsssseeeeeiii....iiittttssssnnnnkrrrrssssllyeeellllooowwwhhoooorrrr,,,,ssssekkkknnneeeeellllaaaasssshhhhiievvvnnnttttmeetttttrrr----iiii,,,,,,sssuuuussppppiiissssoooooooodonnnneeeccccmmmtttuuubbbbnnnnaacccceeeessssaaarrhhhwwwwwwebbbbaaaa....rrreeeehhhhttttoottttddddsssiiionppppaaaassttttheeecccchhhaatttoooccoooohhhheeeenwwwwttaaaatccccttt....ssssiiieaaalluukktttaaasooooeeerrrr))))nnnaaaacccckkhhhtttooooggggo,ooossssdddddllllaiaaattttaaaaooooiipppiieee....ntttt“““rrrrrrrraaaannneepppssrrrrcaaaa,,,,uuuurrroooooonnnntttfrrrrnneeeeggaaaayorrrrppphhhddddaaaarmmmmoonnnsssssseeeennnntt,,anrrrwwwwnnnnlllliiieeeeeeennttt’’sccccoootttcyyyyMMMeeeeuuuttgnnnnss2222ooooiiiuiiiihhdddooooppptnnnnvvvaadddttttrttttttttioooorddhhhhrrrhhhheerrriiiiaPPP’’’’tttteeeoeeefnnnneeeppppttttrrffiiisssssssstooooa,,,HHHnnnnhhhhaaaggiieellll....sssucccceeeerrllllceeeepppttttttsssssaaeeeehhhhrrrrl,,,,SSSsseeewssseggggssarrrrrmmmmrrrrtteeeeaaa...dddd,,,mmoooggggt”””iccchhhhoossssonnnccieeeeaaaiiiitfffiiiiaaaohttttrrteeeeooeeeeennnnaaaadddooootttthTTTmmmnaaaannsssttttimmeeeeggggttrrrrhhhhneoossssddddhhhddddttsssspppllll,,,,,riiieeggggpp....eee....mmaaaatooouuuheeeeetrrrrffnnnssshaaggggetiiaaaaaaacrrayyrrrroooeeeesslll.))))nrrrrrrr)tt SbAetusttdoueodnestnhstowrmthuaonstdfbaoeiluittnoocfcoocmommpplpilaylniawcneictwehiwothuitrhdrdderrseessscssoccdooeddaeetpwaolillliltciyrm.eemsadiunrinngththeecshcohiocoelsd/IaSyS. rFooormexuanmtpillea, parsotupdeernct’hsadnrgeessoofrctlopthing miEbdIassfateixasmapattryrnoruseeoymotpmuivtnsseidiecohsdeeshtntoneroi,rutdtnhtoac.ielasthdineaodadvinrsnreekasognstelueystddrtlrceaoteosoyfg,d,ahacebhlroe’otdesmaedlrloleytpehrslnpsiisagsaihonentoefhrdcrctwerhishenaieweqlgflrelui,otftdihmaycrrec,aedametsokriseroaeesndn-amsu.utdpcoewio,rsthdeatoPrineaslEadeecpnRvtosmieitolSnarionOcenfdrydtdeNa.oiscinAstogchiLofieipnndlPe,ridpnRceuloasaOscrmcyadPetpc;eiElooehinRemnosasTw,eledaYeqpnvurbdoeeycrnl,etachswteese.hrwaerdneilmvlheinernotiostsrtbrsaeahctpeikoeintrsomawtsihattielenkdiainnpofgprn,arocMthptierPoiHnagtaSewr,micatahemnintpmtuhsaeyor SmPisIbAsftartroaimuoapsnlyttdresgeueonmetcduivnltneaeiditntsrdeyseegtttonermweumtduthchrss.iuest.uoisemodHatlfnrsfbaesekareibselolesydifdtnacoatmbrooyceecd,ooioaesmnnhlm’otgeesepmyprollcieelrohaaynrinusgswhutcotioegehotirhtguwwhreehseiriseoqlttwlhrviuuofadiirdatrnlrhreucdesemea:srsybsaes1eolsdn)eucmsutsorIoedcwdtporoeetherndooaisteslcpaiteefhnewavysroleititlaonalryltllenf.il,rrmddaTy3eicieno)mhstsugciReaoidripeinunfnpql,arieupnicrnneloausagsrmolcttytnhteyphaac;eleloaihlceonasnohsccrswd,ktoheiaeqeiocscnvruloteedeaelassrnfndl/,faIicdanwSteoye.Skh.rfaeerrMmFeneopovaohPrenimeHrtentxolseSuorarbcnmsatkthhrcpieealekdlteait,nsacopatoawtrntashaontlerllupokeditetisninermpbfngreocet,an’hscets,hsatridae4nbors)gngleeeeDsadwsr,ofomioof2tnrhre)cnoitlnDlottoptomtlshhetaanienovyogret SPicbIhtsifleotrmouoapmttetdorhseesoeoitc.nuvntasgditshdy,seoonetpwhrdututehr.iryassoneeaaldsfsfra,keoiebelutfydcrtteo.tobqolfecyuioaciennlomntggmetprlacyplhrayloituisaawutnrinoogicrtdueehhtsoeweondwruitdidbrhterhydesdksrrtysheseo,sisduesscuvracecefoposetdr.dtoPoeeeEpraIpintewRaoriiiltStsnliyalOcf.baryrlNaT.escmstAhtu,ieadLothinefnenP,atcRifnlouroOemltotshPyrppeEoleaintcRecnshs.Tdi,ob5aYii)scnltieWdtasyfl/efaItStoeoeSnrfacrdrMoeeouvqoPreumaHratgstSeueblnyaytorcisulekeatctnoouporltrteehoaerppveieeesnrrpfserooclaennhccasattilnrboopgnlnereoiwcofpiofedtrhrcetivlynlooictatshhettsienaoaglrtl SiPrssccubbhtTsiettallrrnotrmooooaiimhuopimnnltltsetedrhehsoggeeesonneiicna.nnipvnlltadnaaggiiietsmbttsrrdy,,sreeggtlioetrppeimmoweehunduuudecishrssss.rrsiyuts..uusscotieseermmoHHaalapssfnlfrta,,eeilsseaicyrrieebolooileettfnyoffdccrtnaaeo..oahmmbrrqnylleeaectyyu,oodhsioiissennnhuannmtoongeetechggmmtyytpealoaacyeelrroorrraysaioorrtusscgnawuuhuuthoohrdinneggoogttitohhtddggouewthmeeeelotsooeirrssolnnrdttswlvvsuiiueeoofddaailbaraatennlleerhyuucrdssssccheaa::kkhrtyhabbhssae11oeslla,,is))eeusemsccbsssvrIIaateofddcettuffopeorooseeeedrenr.nndttPSoeeessttesEcEnccprriivIeffoiihhtteiwARvyyaa,onrooieiRlatSttsaaoolrayraalOlllleoCts.bball,,ertllldNuHTldyy33eeseidoo))msstAhsduo,,euuAcRReadLrnttirrshhNpeeietuffnpp'qqeenlPsaoDbieeuutncRriffslrrneelloautrssSooOhassercoolEtoottyentsknnhPyrrapcIaaeaaceElZoerellotall,shnttcRooUnaaccn.hshccrrs..TadRiikkttoeb55sniiYIqeeiEcci/))sdlchlrrullltieeeWWeetaeaassssygrnfann/eeafIiicfbtddnnlSeoeeeeot.SkklnnsfyaaaoueeccdrnMmmeecoobeogppouusqaaoPitnrrnnauiimaaHcttnnngaggellscteeSeeurooe,rrencclnsyyoaysttkkthhoor.rieeasuuaalevTddnettaettrdcnaaoocchau/pttoaaioirllncrnntraaeeeleonnllaaerlldpspoovvetttieetteeosiiflrrmmaplbbsieeweetooclleeneennhisseescce,,asaprrttnilaad44nrrbfoosse))pgoleennepereDDrddmoiieccc,,ofpooreeotf22eddmydnnrr))ceetooevvltywDDlonhttoiicctiteooallslheeeerttlKaaessnninaovvb-ooaaigl9reeesttttl PshcstTiteormoahonmlretefceiesnshca.cta.diasmtyteeotimhdnueirsasys.nterHadlafrteleiraboewfnyraehebrqneaeusifsenotonrghmctelecyemraitusgeauthnrigogttguetweotsesildtswlieoibatnerhyscc:htyho1oani)uetsvraItdecupsetder.nPSoedtEEnpi.IftteARSy,ritRatSsuayOldCs.alteNuHTynsdotAhuseuAedLnriNnetfp'nPsaDuetcRlnroursSaOecolEutsknPytpIehaEZorloa,nRUranhsirTzdRiitbseiYEci/dshlltieeatasyrrfefibtanoeoslfaaoodnMfmegcqaPianumHngaspteSe,rulosaythrrwsaevetielcnlchuoaaircntuelnteropoemietsfrpbasietootinnicesasriladblseypleeerbdmoe,fpeo2esdrru)tbtyDlhojeeoascrttentaootiolrstl TrrcuurbhcstTieeeelornnmhoaasaihniimneptssrteefhssoogcoiesaishnnan.nppdlca.daasgaeemsmbbir,trrbglleiiitpeeiioonehdnluiddieisstssrasiiyyuuutsccntrssermaafaadappsolltrt,iillsrleiccyyoaeohoiinwtfnoofccir,nnse.oohme/fqnnhlnaattyuoddhhescfienrouuaanutnrettcchbglcttytteeaalyeayhrrmorrssaaaiortccgvnnenauhhohnirdddnooogtttoohdrooestmmw.elolttoeraiWnrrldsfvssuulfeeedaellbaaaeealeeryufrrrscicchheackrhthhaabmhosceessla,nielssoectybbssvnaateeffecbctufooeeosteeedrrenn.tSrlDedesinEccencrvv.IeIooivhttiiASSda,oonneoitCRllattsuottaarrahhIldooCttsba,PeeaatellluHlldd3ttLneseed)stpddIeuoos,eAaRNadrrntricsshNneeEetuuhff'qennsooDbbuutPtrrfisslnelnottrOSoahhaasecdEuoteennsLkitrvaapccIadehIlliZoeerCttodls,sshhntoUrtuc..Ihsuic.aEzaRiidkbl5snneSIIeeEi/d)ddllshnlrllitWeeteatuasssyggrraadneeaaffbetdalleeoenessttklnotssyyaoouuecdnesfeccobbhxegpoocussqapittannrnraauiemacctenngrageeilsccptterreoeh,eeunnclissyosysscskor..eewaacsusvTTdnnoeietlrrddcnaaolhaau//cctiiooairelanncrraueerdleelnateelddssopvmttwmtieeooifllrmaailliasiecetwwtothlennienisscusceeu,apptsnnlcd4rr.lcffooey)pooenepprDrrbsmoieeccsceporreeettedmmsayydnruentoeevbtywwdnnhtijceiittealllleecretllKKaestaavbbr--taionl99eeestl confiscated and law enforcement will be contacted. Students in unauthorized areas of campus will automatically be subject to TsrOurIscTfeeceonhpashahnieappsrtoessocoooeahsnanrqlpdtt.d/asuuucemmbideonrbliinemeiiionntlnciydimisettssiyustScturc:srafacnhapolPthtiiloritcyoooooyhinowsnocil,esnse,ohse/frnhoraatvdhenrscBiruaouctletchtbolextteecaypthkdorursaeailcgdvntnsfhahoiieddoiootltollenro)stmo.n,.lotwatPWrisfsouOfeRetnelahaeWaerfrer(cpiche4Erhehamg0aRcesautlsoemiybsdCndtefibecuoenelaeedlrniuSnlrlnDDeintdEceenedveIIo/vssteiASSod,)onetrCCefRlat(ttaornhfhIItoCtsrlhtPPeaaatliiuHlodttLLgcsednpordIIeoae,pAanNNarnnurdcisNEEettnnuhfu'nso-DivbcssPPtriisltchnootOOShhamcldaEaoenLLktietvaocIdeiIInlMiZloerCCtdts,shnUstuP.IIhsumuaEERHidslmsnaSSpIeSE/ydlshnealtenteyuitssgrnhsadriavafbeoeletoennsstlluotsy,svoulteensotucbhxguodsipapnittnen-araencoenrgtrethftiscti-rehe,cesmniicsospscshar.teaaycuostvTnodoieordnbalehan/ecnciosieantcurirsdlensbneuedspebmtwaieiofjlnneailiwigcetscwthnitooissusreuuntpksonsc,dr.pcfoeraoteeepehsrnsmfescesediregretemafrydndoanmelltwdflnhooetiteonlrwlrelKteaittnhhbr-oin9geeesr TrrDIcscfeeeoohismannseaprrfsacouieaishsnpqndct.sutudamiidevetbeinreeindlncoiisettsfatystuntrc:dhfadhoePetoirlnooasohtnwcwssih,esewose/frhnoahenlcBforoouylratbloectrecayeethkrom.saaedvenfnnoiedottltlerosow.ntuwatiWtilfolfotnebfhaefcer(ile4cramgo0scunslomityadnarcibecnetleeeiurlntdintoeee.evssrSd)eetfpu(ttoohhtdrhraaetittncstpotoespanaturidchnenhueniucstFintshnramadaountinetvdhtnMiodOtsrtuPfumiafzHdileaceSdyesnttatuitsonhrdeavaemaltonssleotsvoeteestfuhxwdcpapaeiaremnterrhttiptiehacmunniispcsaaeawycsdtoiimolnbalneccianeauiirsdnsntuetorbmwamajteiiaowctcthrtio.scuruStaksoclt.lucyatedhsbsesesenigtsafsnounmwlbdljhoeenlwocettaianrotronger TwssOrIcfeccohipmhhnleaploosaorooeaiserqnlldttc//uuduccmedeeooniinrvemmintnecoyimmetsfastStuurc:chacnnhoPethiiointtooosoyysnowcsehl,essqe,oseefurorroaevvnrlcBniiouycclectoleeexetcayptekddroua.eealcdttnsfaahoiedoiitllltlen))isomn,,.twatPPeifoOOfRtnhWWaeer(pye4EEeg0aaRRcurtoeemidCCnPdsiecOeeenlaellniunllrWnDtntd.eeddeI/EsseeSod)ttRrCeef(tonnhfItBrlhttPaaiiiLootLgcsnnoOrIea,,pnNanCudciiEtnnnhKu--ivcsssPiitDcchnoOhhmldaEaooLtieTtvooiInMilloECdtnssuNPIsmuuaEHTsslmaSppSIyseeaOtnnyuitNnhssdriivaeooetonnnslut,,svlteeootuxuudippntte--aenoortrthfftii--eecssmniccpschhateayuoostdooioballenencssatuuisdnssbueppebmaeeijnnneiwgcssciitooossruunntkosc,, pcrrateeeehsnsffseseedigrreafrrndoaanmllldflooettoonlrwetaitttnhhhrongeeer wTOirrDiInsfeehipismclsbeappllruaoourdsidsenrpneetetcsutcdueiiibdvenbisourveeiitlonnteoiysnttaftayturShttcecdhfocehooeenhoranntoososyshttocssspeihllieqse,igwos/m,unhoohesenirlotnmeroeyevcadtbaexeernearpettehrdooiuta.saayltecvtsfh,hnooiieoorotltylnrrfioo.mo.upwflWrtoleoewoRtqwehfeueiefcrepniylrneabgmgacasluorsytleeicyaddoksrbefeelaeDnitnlntthieod.eete/vseroneeprfptatoiofhrorltranaittcgctiuporosalananatrdrhteuenitvcnhtFitsfeorralaoadantncitdtstiiMocoOsrnntPefus.tfHdiimoceSRnenaetyttosaohfsraameotlthssneuoesseltsttuaehwdiaansecirtntheuththedtrheaemninassatntaycudmdod/monbaerecnyinetMirbssbnuePterbwHiaajntesiSogtcshrita.gsuduStnsmoset.puditednhnteieosndtterfPsadoBtwlifloDhoonrwowaitannhirldgeel DCCeeISllllCppRhhooInnMeessINaannAddTooIttOhheeNrr,eeHlleeAccttRrrooAnniiSccSddMeevvEiiccNeeTss hhAaaNvveeDffooBrrUeevvLeerrLccYhhIaaNnnGggeeddCooOuuMrr wwPooLrrAllddI..NWWThhPiiRlleeOiittCiissEnnDooUtt aaRggEaaiinnPssottlssiccyhhooCooolldrreuu:llee1ss7tt2oo0cc/4aarr0rr1yy5aa/7cc2ee

[close]

Comments

no comments yet